eF-site ID 6qxz_20-AB
PDB Code 6qxz
Model 20
Chain A, B

click to enlarge
Title Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking peptide monomethylated on lysine 4
Classification TRANSFERASE
Compound Histone-lysine N-methyltransferase ASHH2
Source (6QXZ)
Sequence A:  GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESS
RWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADA
B:  ARTXQTARY
Description


Functional site

1) chain A
residue 868
type
sequence C
description binding site for residue ZN A 1001
source : AC1

2) chain A
residue 871
type
sequence C
description binding site for residue ZN A 1001
source : AC1

3) chain A
residue 893
type
sequence C
description binding site for residue ZN A 1001
source : AC1

4) chain A
residue 904
type
sequence C
description binding site for residue ZN A 1001
source : AC1

5) chain A
residue 858
type
sequence S
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

6) chain A
residue 859
type
sequence E
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

7) chain A
residue 860
type
sequence F
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

8) chain A
residue 861
type
sequence T
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

9) chain A
residue 864
type
sequence A
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

10) chain A
residue 865
type
sequence W
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

11) chain A
residue 874
type
sequence W
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

12) chain A
residue 915
type
sequence I
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

13) chain A
residue 919
type
sequence L
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

14) chain B
residue 3
type
sequence T
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

15) chain B
residue 6
type
sequence T
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

16) chain B
residue 7
type
sequence A
description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3
source : AC2

17) chain B
residue 3
type MOD_RES
sequence T
description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088
source Swiss-Prot : SWS_FT_FI2

18) chain B
residue 4
type MOD_RES
sequence X
description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708
source Swiss-Prot : SWS_FT_FI3

19) chain B
residue 5
type MOD_RES
sequence Q
description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594
source Swiss-Prot : SWS_FT_FI4

20) chain B
residue 6
type MOD_RES
sequence T
description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790
source Swiss-Prot : SWS_FT_FI5

21) chain B
residue 8
type MOD_RES
sequence R
description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433
source Swiss-Prot : SWS_FT_FI6

22) chain A
residue 903-915
type prosite
sequence DCSKSQEMSNEEI
description EF_HAND_1 EF-hand calcium-binding domain. DCSKSQEMSneEI
source prosite : PS00018

23) chain B
residue 2
type MOD_RES
sequence R
description Citrulline; alternate => ECO:0000269|PubMed:16567635
source Swiss-Prot : SWS_FT_FI1

24) chain A
residue 871
type MOD_RES
sequence C
description Citrulline; alternate => ECO:0000269|PubMed:16567635
source Swiss-Prot : SWS_FT_FI1

25) chain A
residue 893
type MOD_RES
sequence C
description Citrulline; alternate => ECO:0000269|PubMed:16567635
source Swiss-Prot : SWS_FT_FI1

26) chain A
residue 904
type MOD_RES
sequence C
description Citrulline; alternate => ECO:0000269|PubMed:16567635
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links