eF-site ID 6qm7-L PDB Code 6qm7 Chain L click to enlarge Title Leishmania tarentolae proteasome 20S subunit complexed with GSK3494245 Classification HYDROLASE Compound Proteasome alpha1 chain Source ORGANISM_SCIENTIFIC: Leishmania tarentolae; Sequence L:  TTTLAFRFNGGIIVAVDSRASTGQYIASQTVMKVLEINDY LLGTLAGGAADCQYWERVLGMECRLWELRNGSRITVAAAS KILANITYAYRNHGLSMGTMVAGWDQFGPSLYYVDDKGSR VKQDLFSVGSGSIYAYGVLDTGYRKDLSVEDACDLARRSI FHATYRDGASGGIVTVYHVHEKGWTKISRDDQTKLYHRYF PS Description Functional site 1) chain L residue 100 type sequence T description binding site for residue J6E L 4000 source : AC1 2) chain L residue 120 type sequence S description binding site for residue J6E L 4000 source : AC1 3) chain L residue 122 type sequence G description binding site for residue J6E L 4000 source : AC1 4) chain L residue 146 type sequence G description binding site for residue J6E L 4000 source : AC1 5) chain L residue 195 type sequence S description binding site for residue J6E L 4000 source : AC1 6) chain L residue 196 type sequence M description binding site for residue J6E L 4000 source : AC1 7) chain L residue 197 type sequence G description binding site for residue J6E L 4000 source : AC1 8) chain L residue 212 type sequence Y description binding site for residue J6E L 4000 source : AC1 9) chain L residue 214 type sequence D description binding site for residue J6E L 4000 source : AC1 10) chain L residue 215 type sequence D description binding site for residue J6E L 4000 source : AC1 11) chain L residue 226 type sequence S description binding site for residue J6E L 4000 source : AC1 12) chain L residue 227 type sequence V description binding site for residue J6E L 4000 source : AC1 13) chain L residue 228 type sequence G description binding site for residue J6E L 4000 source : AC1 14) chain L residue 229 type sequence S description binding site for residue J6E L 4000 source : AC1 15) chain L residue 231 type sequence S description binding site for residue J6E L 4000 source : AC1 16) chain L residue 103-150 type prosite sequence LAFRFNGGIIVAVDSRASTGQYIASQTVMKVLEINDYLLG TLAGGAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. MAMaGkeCFVIISDnrlgeqlktistevp.KlhvvndsivygltGlrTD source prosite : PS00854

Display surface Download Links