eF-site ID 6q8i-A
PDB Code 6q8i
Chain A

click to enlarge
Title Nterminal domain of human SMU1 in complex with human REDmid
Classification SPLICING
Compound WD40 repeat-containing protein SMU1
Source (RED_HUMAN)
Sequence A:  IEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVD
SIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVL
ELIELRELGAARSLLRQTDPMIMLKQTQPERYIHLENLLA
RSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVVPPSRLM
ALLGQALKWQQHQGLLPPGMTIDLFRG
Description (1)  WD40 repeat-containing protein SMU1, Protein Red

Display surface

Download
Links