eF-site ID 6q8f-AB PDB Code 6q8f Chain A, B click to enlarge Title Nterminal domain of human SMU1 Classification SPLICING Compound WD40 repeat-containing protein SMU1 Source (SMU1_HUMAN) Sequence A:  IEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVD SIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVL ELIELRELGAARSLLRQTDPMIMLKQTQPERYIHLENLLA RSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVVPPSRLM ALLGQALKWQQHQGLLPPGMTIDLFRGKAAVKDVKFP B:  IEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVD SIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVL ELIELRELGAARSLLRQTDPMIMLKQTQPERYIHLENLLA RSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVVPPSRLM ALLGQALKWQQHQGLLPPIDLFRG Description (1)  WD40 repeat-containing protein SMU1 Functional site 1) chain A residue 78 type sequence E description binding site for residue BTB A 601 source : AC1 2) chain A residue 116 type sequence H description binding site for residue BTB A 601 source : AC1 3) chain A residue 131 type sequence A description binding site for residue BTB A 601 source : AC1 4) chain A residue 132 type sequence Y description binding site for residue BTB A 601 source : AC1 5) chain A residue 133 type sequence P description binding site for residue BTB A 601 source : AC1 6) chain A residue 134 type sequence D description binding site for residue BTB A 601 source : AC1 7) chain A residue 141 type sequence R description binding site for residue BTB A 601 source : AC1 8) chain B residue 25 type sequence R description binding site for residue CL B 601 source : AC2 9) chain B residue 171 type sequence W description binding site for residue CL B 601 source : AC2

Display surface Download Links