eF-site ID 6q7m-Z PDB Code 6q7m Chain Z click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence Z:  HPHLLAERISRLSSSLEKGLYERSHAIRLCLLAALSGESV FLLGPPGIAKSLIARRLKFAFQNARAFEYLMTRFSTPEEV FGPLSERLTSGYLPEAEIVFLDEIWKAGPAILNTLLTAIN ERQFRNGAHVEKIPMRLLVAASNELPEADSSLEALYDRML IRLWLDKVQDKANFRSMLTSQQDENDNPVPDALQVTDEEY ERWQKEIGEITLPDHVFELIFMLRQQLDKLPDAPYVSDRR WKKAIRLLQASAFFSGRSAVAPVDLILLKDCLWYDAQSLN LIQQQIDVLMTGHAWQQQGMLTRLGAIVQRHLQLQQQQKT ALTVIRLGGIFSRRQQYQLPVNVTASTLTLLLQKPLKLHD MEVVHISFERSALEQWLSKGGEIRGKLNGIGFAQKLNLEV DSAQHLVVRDVSLQGSTLALPGSLPGEIKQQLEELESDWR KQHALFSEQQKCLFIPGDWLGRIEASLQDVGAQIRQAQQ Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain Z residue 22 type sequence L description binding site for residue ADP Z 800 source : AC7 2) chain Z residue 25 type sequence R description binding site for residue ADP Z 800 source : AC7 3) chain Z residue 48 type sequence P description binding site for residue ADP Z 800 source : AC7 4) chain Z residue 49 type sequence G description binding site for residue ADP Z 800 source : AC7 5) chain Z residue 50 type sequence I description binding site for residue ADP Z 800 source : AC7 6) chain Z residue 51 type sequence A description binding site for residue ADP Z 800 source : AC7 7) chain Z residue 52 type sequence K description binding site for residue ADP Z 800 source : AC7 8) chain Z residue 53 type sequence S description binding site for residue ADP Z 800 source : AC7 9) chain Z residue 54 type sequence L description binding site for residue ADP Z 800 source : AC7 10) chain Z residue 189 type sequence M description binding site for residue ADP Z 800 source : AC7

Display surface Download Links