eF-site ID 6q7m-S PDB Code 6q7m Chain S click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence S:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain S residue 398 type sequence T description binding site for Di-peptide PLP O 801 and LYS O 367 source : AE2 2) chain S residue 399 type sequence T description binding site for Di-peptide PLP O 801 and LYS O 367 source : AE2 3) chain S residue 400 type sequence S description binding site for Di-peptide PLP O 801 and LYS O 367 source : AE2 4) chain S residue 219 type sequence G description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 5) chain S residue 220 type sequence T description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 6) chain S residue 221 type sequence S description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 7) chain S residue 245 type sequence H description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 8) chain S residue 330 type sequence D description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 9) chain S residue 332 type sequence A description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 10) chain S residue 333 type sequence W description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 11) chain S residue 364 type sequence S description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 12) chain S residue 365 type sequence T description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 13) chain S residue 366 type sequence H description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 14) chain S residue 368 type sequence L description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 15) chain S residue 369 type sequence L description binding site for Di-peptide PLP S 801 and LYS S 367 source : AE6 16) chain S residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links