eF-site ID 6q7m-Q PDB Code 6q7m Chain Q click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence Q:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain Q residue 151 type sequence G description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 2) chain Q residue 398 type sequence T description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 3) chain Q residue 399 type sequence T description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 4) chain Q residue 400 type sequence S description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 5) chain Q residue 219 type sequence G description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 6) chain Q residue 220 type sequence T description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 7) chain Q residue 221 type sequence S description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 8) chain Q residue 245 type sequence H description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 9) chain Q residue 330 type sequence D description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 10) chain Q residue 332 type sequence A description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 11) chain Q residue 333 type sequence W description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 12) chain Q residue 364 type sequence S description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 13) chain Q residue 365 type sequence T description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 14) chain Q residue 366 type sequence H description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 15) chain Q residue 368 type sequence L description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 16) chain Q residue 369 type sequence L description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 17) chain Q residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links