eF-site ID 6q7m-M PDB Code 6q7m Chain M click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence M:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain M residue 219 type sequence G description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 2) chain M residue 220 type sequence T description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 3) chain M residue 221 type sequence S description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 4) chain M residue 245 type sequence H description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 5) chain M residue 330 type sequence D description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 6) chain M residue 332 type sequence A description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 7) chain M residue 333 type sequence W description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 8) chain M residue 365 type sequence T description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 9) chain M residue 366 type sequence H description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 10) chain M residue 368 type sequence L description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 11) chain M residue 369 type sequence L description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 12) chain M residue 151 type sequence G description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 13) chain M residue 398 type sequence T description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 14) chain M residue 399 type sequence T description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 15) chain M residue 400 type sequence S description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 16) chain M residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links