eF-site ID 6q7m-H PDB Code 6q7m Chain H click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence H:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain H residue 151 type sequence G description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 2) chain H residue 398 type sequence T description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 3) chain H residue 399 type sequence T description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 4) chain H residue 400 type sequence S description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 5) chain H residue 219 type sequence G description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 6) chain H residue 220 type sequence T description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 7) chain H residue 221 type sequence S description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 8) chain H residue 245 type sequence H description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 9) chain H residue 330 type sequence D description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 10) chain H residue 332 type sequence A description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 11) chain H residue 333 type sequence W description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 12) chain H residue 365 type sequence T description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 13) chain H residue 366 type sequence H description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 14) chain H residue 368 type sequence L description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 15) chain H residue 369 type sequence L description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 16) chain H residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links