eF-site ID 6q7l-R PDB Code 6q7l Chain R click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence R:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain R residue 151 type sequence G description binding site for Di-peptide PLP K 801 and LYS K 367 source : AD7 2) chain R residue 398 type sequence T description binding site for Di-peptide PLP K 801 and LYS K 367 source : AD7 3) chain R residue 400 type sequence S description binding site for Di-peptide PLP K 801 and LYS K 367 source : AD7 4) chain R residue 219 type sequence G description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 5) chain R residue 220 type sequence T description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 6) chain R residue 221 type sequence S description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 7) chain R residue 245 type sequence H description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 8) chain R residue 330 type sequence D description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 9) chain R residue 333 type sequence W description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 10) chain R residue 364 type sequence S description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 11) chain R residue 365 type sequence T description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 12) chain R residue 366 type sequence H description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 13) chain R residue 368 type sequence L description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 14) chain R residue 369 type sequence L description binding site for Di-peptide PLP R 801 and LYS R 367 source : AE5 15) chain R residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links