eF-site ID 6q7l-P PDB Code 6q7l Chain P click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence P:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain P residue 151 type sequence G description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 2) chain P residue 398 type sequence T description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 3) chain P residue 399 type sequence T description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 4) chain P residue 400 type sequence S description binding site for Di-peptide PLP M 801 and LYS M 367 source : AD9 5) chain P residue 219 type sequence G description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 6) chain P residue 220 type sequence T description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 7) chain P residue 221 type sequence S description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 8) chain P residue 245 type sequence H description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 9) chain P residue 330 type sequence D description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 10) chain P residue 332 type sequence A description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 11) chain P residue 333 type sequence W description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 12) chain P residue 364 type sequence S description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 13) chain P residue 365 type sequence T description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 14) chain P residue 366 type sequence H description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 15) chain P residue 368 type sequence L description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 16) chain P residue 369 type sequence L description binding site for Di-peptide PLP P 801 and LYS P 367 source : AE3 17) chain P residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links