eF-site ID 6q7l-L PDB Code 6q7l Chain L click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence L:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain L residue 219 type sequence G description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 2) chain L residue 220 type sequence T description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 3) chain L residue 221 type sequence S description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 4) chain L residue 245 type sequence H description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 5) chain L residue 330 type sequence D description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 6) chain L residue 332 type sequence A description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 7) chain L residue 333 type sequence W description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 8) chain L residue 364 type sequence S description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 9) chain L residue 365 type sequence T description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 10) chain L residue 366 type sequence H description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 11) chain L residue 368 type sequence L description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 12) chain L residue 369 type sequence L description binding site for Di-peptide PLP L 801 and LYS L 367 source : AD8 13) chain L residue 151 type sequence G description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 14) chain L residue 398 type sequence T description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 15) chain L residue 400 type sequence S description binding site for Di-peptide PLP Q 801 and LYS Q 367 source : AE4 16) chain L residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links