eF-site ID 6q7l-E PDB Code 6q7l Chain E click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence E:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain E residue 219 type sequence G description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 2) chain E residue 220 type sequence T description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 3) chain E residue 221 type sequence S description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 4) chain E residue 245 type sequence H description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 5) chain E residue 330 type sequence D description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 6) chain E residue 332 type sequence A description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 7) chain E residue 333 type sequence W description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 8) chain E residue 364 type sequence S description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 9) chain E residue 365 type sequence T description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 10) chain E residue 366 type sequence H description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 11) chain E residue 368 type sequence L description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 12) chain E residue 369 type sequence L description binding site for Di-peptide PLP E 801 and LYS E 367 source : AD1 13) chain E residue 151 type sequence G description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 14) chain E residue 398 type sequence T description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 15) chain E residue 399 type sequence T description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 16) chain E residue 400 type sequence S description binding site for Di-peptide PLP H 801 and LYS H 367 source : AD4 17) chain E residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links