eF-site ID 6q7l-D PDB Code 6q7l Chain D click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence D:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain D residue 219 type sequence G description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 2) chain D residue 220 type sequence T description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 3) chain D residue 221 type sequence S description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 4) chain D residue 245 type sequence H description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 5) chain D residue 330 type sequence D description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 6) chain D residue 332 type sequence A description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 7) chain D residue 333 type sequence W description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 8) chain D residue 364 type sequence S description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 9) chain D residue 365 type sequence T description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 10) chain D residue 366 type sequence H description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 11) chain D residue 368 type sequence L description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 12) chain D residue 369 type sequence L description binding site for Di-peptide PLP D 801 and LYS D 367 source : AC9 13) chain D residue 398 type sequence T description binding site for Di-peptide PLP J 801 and LYS J 367 source : AD6 14) chain D residue 399 type sequence T description binding site for Di-peptide PLP J 801 and LYS J 367 source : AD6 15) chain D residue 400 type sequence S description binding site for Di-peptide PLP J 801 and LYS J 367 source : AD6 16) chain D residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links