eF-site ID 6q7l-A PDB Code 6q7l Chain A click to enlarge Title Spiral structure of E. coli RavA in the RavA-LdcI cage-like complex Classification HYDROLASE Compound Inducible lysine decarboxylase Source (J7QAN2_ECOLX) Sequence A:  MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRD DLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLY AFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQT TDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQK SPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEA EQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILI DRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEF QHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKK TLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTS PHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIK RLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNID NEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDE HGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAF DLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVHH NLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEM VGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLC EIGAHYPGFETDIHGAYRQADGRYTVKVLKE Description (1)  Inducible lysine decarboxylase (E.C.4.1.1.18), ATPase RavA (E.C.3.6.3.-) Functional site 1) chain A residue 219 type sequence G description binding site for residue PLP A 801 source : AC1 2) chain A residue 220 type sequence T description binding site for residue PLP A 801 source : AC1 3) chain A residue 221 type sequence S description binding site for residue PLP A 801 source : AC1 4) chain A residue 245 type sequence H description binding site for residue PLP A 801 source : AC1 5) chain A residue 330 type sequence D description binding site for residue PLP A 801 source : AC1 6) chain A residue 333 type sequence W description binding site for residue PLP A 801 source : AC1 7) chain A residue 366 type sequence H description binding site for residue PLP A 801 source : AC1 8) chain A residue 367 type sequence K description binding site for residue PLP A 801 source : AC1 9) chain A residue 151 type sequence G description binding site for Di-peptide PLP F 801 and LYS F 367 source : AD2 10) chain A residue 398 type sequence T description binding site for Di-peptide PLP F 801 and LYS F 367 source : AD2 11) chain A residue 400 type sequence S description binding site for Di-peptide PLP F 801 and LYS F 367 source : AD2 12) chain A residue 362-376 type prosite sequence TQSTHKLLAAFSQAS description OKR_DC_1 Orn/Lys/Arg decarboxylases family 1 pyridoxal-P attachment site. TqStHKllAAfSQAS source prosite : PS00703 13) chain A residue 367 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI1

Display surface Download Links