eF-site ID 6pet-D PDB Code 6pet Chain D click to enlarge Title Crystal structure of 8-hydroxychromene compound 30 bound to estrogen receptor alpha Classification NUCLEAR PROTEIN Compound Estrogen receptor Source (ESR1_HUMAN) Sequence D:  LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGL LTNLADRELVHMINWAKRVPGFVDLTSHDQVHLLECAWLE ILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIF DMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKS LEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLL LILSHIRHMSNKGMEHLYSMKCKNVVPSYDLLLEMLDA Description Functional site 1) chain D residue 346 type sequence L description binding site for residue G9J D 601 source : AC1 2) chain D residue 347 type sequence T description binding site for residue G9J D 601 source : AC1 3) chain D residue 350 type sequence A description binding site for residue G9J D 601 source : AC1 4) chain D residue 353 type sequence E description binding site for residue G9J D 601 source : AC1 5) chain D residue 387 type sequence L description binding site for residue G9J D 601 source : AC1 6) chain D residue 394 type sequence R description binding site for residue G9J D 601 source : AC1 7) chain D residue 424 type sequence I description binding site for residue G9J D 601 source : AC1 8) chain D residue 521 type sequence G description binding site for residue G9J D 601 source : AC1 9) chain D residue 524 type sequence H description binding site for residue G9J D 601 source : AC1 10) chain D residue 525 type sequence L description binding site for residue G9J D 601 source : AC1 11) chain D residue 537 type MOD_RES sequence Y description Phosphotyrosine; by Tyr-kinases => ECO:0000269|PubMed:7539106 source Swiss-Prot : SWS_FT_FI1 12) chain D residue 447 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links