eF-site ID 6p69-B PDB Code 6p69 Chain B click to enlarge Title Crystal structure of FGFR1-Y563C (FGFR4 surrogate) covalently bound to compound 11. Classification TRANSFERASE Compound Fibroblast growth factor receptor 1 Source (FGFR1_HUMAN) Sequence B:  SEYELPEDPRWELPRDRLVLGKPLGEGAFGQVVLAEAIGL PNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNI INLLGACTQDGPLYVIVECASKGNLREYLQARRPPEEQLS SKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNV MKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRI YTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEG HRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDR IVALTS Description (1)  Fibroblast growth factor receptor 1 (E.C.2.7.10.1) Functional site 1) chain B residue 570 type ligand sequence R description binding site for residue SO4 B 801 source : AC5 2) chain B residue 627 type ligand sequence R description binding site for residue SO4 B 801 source : AC5 3) chain B residue 657 type ligand sequence T description binding site for residue SO4 B 801 source : AC5 4) chain B residue 659 type ligand sequence N description binding site for residue SO4 B 801 source : AC5 5) chain B residue 661 type ligand sequence R description binding site for residue SO4 B 801 source : AC5 6) chain B residue 574 type ligand sequence Q description binding site for residue SO4 B 802 source : AC6 7) chain B residue 659 type ligand sequence N description binding site for residue SO4 B 802 source : AC6 8) chain B residue 661 type ligand sequence R description binding site for residue SO4 B 802 source : AC6 9) chain B residue 699 type ligand sequence S description binding site for residue SO4 B 802 source : AC6 10) chain B residue 684 type ligand sequence W description binding site for residue EDO B 803 source : AC7 11) chain B residue 701 type ligand sequence Y description binding site for residue EDO B 803 source : AC7 12) chain B residue 713 type ligand sequence L description binding site for residue EDO B 803 source : AC7 13) chain B residue 718 type ligand sequence R description binding site for residue EDO B 803 source : AC7 14) chain B residue 719 type ligand sequence M description binding site for residue EDO B 803 source : AC7 15) chain B residue 737 type ligand sequence W description binding site for residue EDO B 803 source : AC7 16) chain B residue 484 type ligand sequence L description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 17) chain B residue 492 type ligand sequence V description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 18) chain B residue 494 type ligand sequence L description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 19) chain B residue 510 type ligand sequence K description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 20) chain B residue 514 type ligand sequence K description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 21) chain B residue 531 type ligand sequence E description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 22) chain B residue 535 type ligand sequence M description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 23) chain B residue 559 type ligand sequence V description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 24) chain B residue 561 type ligand sequence V description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 25) chain B residue 562 type ligand sequence E description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 26) chain B residue 564 type ligand sequence A description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 27) chain B residue 565 type ligand sequence S description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 28) chain B residue 630 type ligand sequence L description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 29) chain B residue 640 type ligand sequence A description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 30) chain B residue 641 type ligand sequence D description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 31) chain B residue 642 type ligand sequence F description binding site for Di-peptide O21 B 804 and CYS B 563 source : AC8 32) chain B residue 484-514 type prosite ligand sequence LGEGAFGQVVLAEAIGLPNRVTKVAVK description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K. source prosite : PS00107 33) chain B residue 619-631 type prosite ligand sequence CIHRDLAARNVLV description Tyrosine protein kinases specific active-site signature.[LIVMFYC]-{A}-[HY]-x-D-[LIVMFY]-[RSTAC]-{D}-{PF}-N-[LIVMFYC](3). source prosite : PS00109

Display surface Download Links