eF-site ID 6p68-C PDB Code 6p68 Chain C click to enlarge Title Crystal structure of FGFR1-Y563C (FGFR4 surrogate) covalently bound to compound 22. Classification TRANSFERASE Compound Fibroblast growth factor receptor 1 Source (FGFR1_HUMAN) Sequence C:  YELPEDPRWELPRDRLVLGKPLGEGAFGQVVLAEAIGLDK DKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK NIINLLGACTQDGPLYVIVECASKGNLREYLQARRPPEEQ LSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTED NVMKIADFGLARDIDYYKKTTNGRLPVKWMAPEALFDRIY THQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGH RMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRI VALTSN Description Functional site 1) chain C residue 484 type sequence L description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 2) chain C residue 492 type sequence V description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 3) chain C residue 494 type sequence L description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 4) chain C residue 510 type sequence K description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 5) chain C residue 512 type sequence A description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 6) chain C residue 514 type sequence K description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 7) chain C residue 531 type sequence E description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 8) chain C residue 535 type sequence M description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 9) chain C residue 545 type sequence I description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 10) chain C residue 561 type sequence V description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 11) chain C residue 562 type sequence E description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 12) chain C residue 564 type sequence A description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 13) chain C residue 565 type sequence S description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 14) chain C residue 630 type sequence L description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 15) chain C residue 640 type sequence A description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 16) chain C residue 641 type sequence D description binding site for Di-peptide O1Y C 801 and CYS C 563 source : AC5 17) chain C residue 623 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028, ECO:0000269|PubMed:19224897 source Swiss-Prot : SWS_FT_FI1 18) chain C residue 484 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 19) chain C residue 514 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 20) chain C residue 562 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 21) chain C residue 568 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 22) chain C residue 627 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 23) chain C residue 641 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 24) chain C residue 463 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16507368, ECO:0000269|PubMed:19224897, ECO:0000269|PubMed:8622701 source Swiss-Prot : SWS_FT_FI3 25) chain C residue 653 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16507368, ECO:0000269|PubMed:19224897, ECO:0000269|PubMed:19665973, ECO:0000269|PubMed:8622701 source Swiss-Prot : SWS_FT_FI4 26) chain C residue 654 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16507368, ECO:0000269|PubMed:19224897, ECO:0000269|PubMed:19665973, ECO:0000269|PubMed:8622701 source Swiss-Prot : SWS_FT_FI4 27) chain C residue 730 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:19224897, ECO:0000269|PubMed:8622701 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links