eF-site ID 6ozl-A PDB Code 6ozl Chain A click to enlarge Title Crystal structure of Mus musculus (Mm) Endonuclease V in complex with a 23mer RNA oligo containing an inosine after a 2 min soak in Mn2+ Classification HYDROLASE Compound Endonuclease V Source (6OZL) Sequence A:  ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQ KVGGVDVSFVKSVRACASLVVLSYPELKVVYEDSRMVGLK APYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGN GVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLENNAL HKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLY VSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIR RTL Description Functional site 1) chain A residue 52 type sequence D description binding site for residue MN A 301 source : AC1 2) chain A residue 240 type sequence D description binding site for residue MN A 301 source : AC1 3) chain A residue 52 type sequence D description binding site for residue MN A 302 source : AC2 4) chain A residue 126 type sequence D description binding site for residue MN A 302 source : AC2 5) chain A residue 32 type sequence D description binding site for residue GOL A 303 source : AC3 6) chain A residue 38 type sequence R description binding site for residue GOL A 303 source : AC3 7) chain A residue 225 type sequence H description binding site for residue PGE A 304 source : AC4 8) chain A residue 226 type sequence H description binding site for residue PGE A 304 source : AC4 9) chain A residue 228 type sequence C description binding site for residue PGE A 304 source : AC4 10) chain A residue 229 type sequence R description binding site for residue PGE A 304 source : AC4 11) chain A residue 45 type sequence L description binding site for residue NA A 305 source : AC5 12) chain A residue 46 type sequence Q description binding site for residue NA A 305 source : AC5 13) chain A residue 52 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 126 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 91 type SITE sequence Y description Interaction with target DNA => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links