eF-site ID 6owm-AB
PDB Code 6owm
Chain A, B

click to enlarge
Title Horse liver F93W alcohol dehydrogenase complexed with NAD and pentafluorobenzyl alcohol
Classification OXIDOREDUCTASE
Compound Alcohol dehydrogenase E chain
Source (ADH1E_HORSE)
Sequence A:  STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKM
VATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESIGEGV
TTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKI
DAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGL
GGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALS
CCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFG
GFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGESIRTILTF
B:  STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKM
VATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESIGEGV
TTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKI
DAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGL
GGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALS
CCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFG
GFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGESIRTILTF
Description (1)  Alcohol dehydrogenase E chain (E.C.1.1.1.1)


Functional site

1) chain A
residue 46
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

2) chain A
residue 67
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

3) chain A
residue 174
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

4) chain A
residue 97
type
ligand
sequence C
description binding site for residue ZN A 402
source : AC2

5) chain A
residue 100
type
ligand
sequence C
description binding site for residue ZN A 402
source : AC2

6) chain A
residue 103
type
ligand
sequence C
description binding site for residue ZN A 402
source : AC2

7) chain A
residue 111
type
ligand
sequence C
description binding site for residue ZN A 402
source : AC2

8) chain A
residue 47
type
ligand
sequence R
description binding site for residue NAJ A 403
source : AC3

9) chain A
residue 48
type
ligand
sequence S
description binding site for residue NAJ A 403
source : AC3

10) chain A
residue 51
type
ligand
sequence H
description binding site for residue NAJ A 403
source : AC3

11) chain A
residue 93
type
ligand
sequence W
description binding site for residue NAJ A 403
source : AC3

12) chain A
residue 174
type
ligand
sequence C
description binding site for residue NAJ A 403
source : AC3

13) chain A
residue 178
type
ligand
sequence T
description binding site for residue NAJ A 403
source : AC3

14) chain A
residue 199
type
ligand
sequence G
description binding site for residue NAJ A 403
source : AC3

15) chain A
residue 201
type
ligand
sequence G
description binding site for residue NAJ A 403
source : AC3

16) chain A
residue 202
type
ligand
sequence G
description binding site for residue NAJ A 403
source : AC3

17) chain A
residue 203
type
ligand
sequence V
description binding site for residue NAJ A 403
source : AC3

18) chain A
residue 223
type
ligand
sequence D
description binding site for residue NAJ A 403
source : AC3

19) chain A
residue 224
type
ligand
sequence I
description binding site for residue NAJ A 403
source : AC3

20) chain A
residue 228
type
ligand
sequence K
description binding site for residue NAJ A 403
source : AC3

21) chain A
residue 268
type
ligand
sequence V
description binding site for residue NAJ A 403
source : AC3

22) chain A
residue 269
type
ligand
sequence I
description binding site for residue NAJ A 403
source : AC3

23) chain A
residue 271
type
ligand
sequence R
description binding site for residue NAJ A 403
source : AC3

24) chain A
residue 292
type
ligand
sequence V
description binding site for residue NAJ A 403
source : AC3

25) chain A
residue 293
type
ligand
sequence G
description binding site for residue NAJ A 403
source : AC3

26) chain A
residue 294
type
ligand
sequence V
description binding site for residue NAJ A 403
source : AC3

27) chain A
residue 317
type
ligand
sequence A
description binding site for residue NAJ A 403
source : AC3

28) chain A
residue 318
type
ligand
sequence I
description binding site for residue NAJ A 403
source : AC3

29) chain A
residue 319
type
ligand
sequence F
description binding site for residue NAJ A 403
source : AC3

30) chain A
residue 369
type
ligand
sequence R
description binding site for residue NAJ A 403
source : AC3

31) chain A
residue 46
type
ligand
sequence C
description binding site for residue PFB A 404
source : AC4

32) chain A
residue 48
type
ligand
sequence S
description binding site for residue PFB A 404
source : AC4

33) chain A
residue 57
type
ligand
sequence L
description binding site for residue PFB A 404
source : AC4

34) chain A
residue 67
type
ligand
sequence H
description binding site for residue PFB A 404
source : AC4

35) chain A
residue 93
type
ligand
sequence W
description binding site for residue PFB A 404
source : AC4

36) chain A
residue 116
type
ligand
sequence L
description binding site for residue PFB A 404
source : AC4

37) chain A
residue 140
type
ligand
sequence F
description binding site for residue PFB A 404
source : AC4

38) chain A
residue 141
type
ligand
sequence L
description binding site for residue PFB A 404
source : AC4

39) chain A
residue 174
type
ligand
sequence C
description binding site for residue PFB A 404
source : AC4

40) chain A
residue 294
type
ligand
sequence V
description binding site for residue PFB A 404
source : AC4

41) chain A
residue 318
type
ligand
sequence I
description binding site for residue PFB A 404
source : AC4

42) chain B
residue 309
type
ligand
sequence L
description binding site for residue PFB A 404
source : AC4

43) chain A
residue 297
type
ligand
sequence D
description binding site for residue MRD A 405
source : AC5

44) chain A
residue 299
type
ligand
sequence Q
description binding site for residue MRD A 405
source : AC5

45) chain A
residue 338
type
ligand
sequence K
description binding site for residue MRD A 405
source : AC5

46) chain A
residue 339
type
ligand
sequence K
description binding site for residue MRD A 405
source : AC5

47) chain A
residue 340
type
ligand
sequence F
description binding site for residue MRD A 405
source : AC5

48) chain A
residue 218
type
ligand
sequence R
description binding site for residue MRD A 406
source : AC6

49) chain A
residue 238
type
ligand
sequence T
description binding site for residue MRD A 406
source : AC6

50) chain A
residue 239
type
ligand
sequence E
description binding site for residue MRD A 406
source : AC6

51) chain B
residue 238
type
ligand
sequence T
description binding site for residue MRD A 406
source : AC6

52) chain B
residue 239
type
ligand
sequence E
description binding site for residue MRD A 406
source : AC6

53) chain B
residue 46
type
ligand
sequence C
description binding site for residue ZN B 401
source : AC7

54) chain B
residue 67
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC7

55) chain B
residue 174
type
ligand
sequence C
description binding site for residue ZN B 401
source : AC7

56) chain B
residue 97
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC8

57) chain B
residue 100
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC8

58) chain B
residue 103
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC8

59) chain B
residue 111
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC8

60) chain B
residue 47
type
ligand
sequence R
description binding site for residue NAJ B 403
source : AC9

61) chain B
residue 48
type
ligand
sequence S
description binding site for residue NAJ B 403
source : AC9

62) chain B
residue 51
type
ligand
sequence H
description binding site for residue NAJ B 403
source : AC9

63) chain B
residue 93
type
ligand
sequence W
description binding site for residue NAJ B 403
source : AC9

64) chain B
residue 174
type
ligand
sequence C
description binding site for residue NAJ B 403
source : AC9

65) chain B
residue 178
type
ligand
sequence T
description binding site for residue NAJ B 403
source : AC9

66) chain B
residue 199
type
ligand
sequence G
description binding site for residue NAJ B 403
source : AC9

67) chain B
residue 201
type
ligand
sequence G
description binding site for residue NAJ B 403
source : AC9

68) chain B
residue 202
type
ligand
sequence G
description binding site for residue NAJ B 403
source : AC9

69) chain B
residue 203
type
ligand
sequence V
description binding site for residue NAJ B 403
source : AC9

70) chain B
residue 223
type
ligand
sequence D
description binding site for residue NAJ B 403
source : AC9

71) chain B
residue 224
type
ligand
sequence I
description binding site for residue NAJ B 403
source : AC9

72) chain B
residue 228
type
ligand
sequence K
description binding site for residue NAJ B 403
source : AC9

73) chain B
residue 268
type
ligand
sequence V
description binding site for residue NAJ B 403
source : AC9

74) chain B
residue 269
type
ligand
sequence I
description binding site for residue NAJ B 403
source : AC9

75) chain B
residue 292
type
ligand
sequence V
description binding site for residue NAJ B 403
source : AC9

76) chain B
residue 293
type
ligand
sequence G
description binding site for residue NAJ B 403
source : AC9

77) chain B
residue 294
type
ligand
sequence V
description binding site for residue NAJ B 403
source : AC9

78) chain B
residue 317
type
ligand
sequence A
description binding site for residue NAJ B 403
source : AC9

79) chain B
residue 318
type
ligand
sequence I
description binding site for residue NAJ B 403
source : AC9

80) chain B
residue 319
type
ligand
sequence F
description binding site for residue NAJ B 403
source : AC9

81) chain B
residue 369
type
ligand
sequence R
description binding site for residue NAJ B 403
source : AC9

82) chain B
residue 46
type
ligand
sequence C
description binding site for residue PFB B 404
source : AD1

83) chain B
residue 48
type
ligand
sequence S
description binding site for residue PFB B 404
source : AD1

84) chain B
residue 57
type
ligand
sequence L
description binding site for residue PFB B 404
source : AD1

85) chain B
residue 67
type
ligand
sequence H
description binding site for residue PFB B 404
source : AD1

86) chain B
residue 93
type
ligand
sequence W
description binding site for residue PFB B 404
source : AD1

87) chain B
residue 116
type
ligand
sequence L
description binding site for residue PFB B 404
source : AD1

88) chain B
residue 140
type
ligand
sequence F
description binding site for residue PFB B 404
source : AD1

89) chain B
residue 141
type
ligand
sequence L
description binding site for residue PFB B 404
source : AD1

90) chain B
residue 174
type
ligand
sequence C
description binding site for residue PFB B 404
source : AD1

91) chain B
residue 294
type
ligand
sequence V
description binding site for residue PFB B 404
source : AD1

92) chain B
residue 318
type
ligand
sequence I
description binding site for residue PFB B 404
source : AD1

93) chain B
residue 338
type
ligand
sequence K
description binding site for residue MRD B 405
source : AD2

94) chain A
residue 46-48
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence CRS
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

95) chain A
residue 51
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

96) chain A
residue 93
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence W
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

97) chain A
residue 174
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence C
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

98) chain A
residue 178
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence T
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

99) chain A
residue 199-204
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence GLGGVG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

100) chain A
residue 222-225
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VDIN
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

101) chain A
residue 228
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence K
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

102) chain A
residue 243
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence P
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

103) chain A
residue 268-271
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VIGR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

104) chain A
residue 274
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence T
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

105) chain A
residue 292-294
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VGV
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

106) chain A
residue 317-320
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence AIFG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

107) chain A
residue 362
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence L
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

108) chain A
residue 368-369
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence IR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

109) chain B
residue 309
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence L
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_A_403

110) chain A
residue 46
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence C
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

111) chain A
residue 48
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence S
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

112) chain A
residue 57
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

113) chain A
residue 67
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence H
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

114) chain A
residue 93
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence W
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

115) chain A
residue 116
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

116) chain A
residue 140-141
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence FL
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

117) chain A
residue 174
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence C
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

118) chain A
residue 294
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence V
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

119) chain A
residue 318
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence I
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

120) chain B
residue 306
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence M
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

121) chain B
residue 309
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_A_404

122) chain A
residue 217-218
type binding
ligand MRD: (4R)-2-METHYLPENTANE-2,4-DIOL
sequence AR
description (4R)-2-METHYLPENTANE-2,4-DIOL binding site
source pdb_hetatom : MRD_6owm_A_406

123) chain A
residue 238-239
type binding
ligand MRD: (4R)-2-METHYLPENTANE-2,4-DIOL
sequence TE
description (4R)-2-METHYLPENTANE-2,4-DIOL binding site
source pdb_hetatom : MRD_6owm_A_406

124) chain A
residue 309
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence L
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

125) chain B
residue 46-48
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence CRS
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

126) chain B
residue 51
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

127) chain B
residue 93
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence W
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

128) chain B
residue 174
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence C
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

129) chain B
residue 178
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence T
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

130) chain B
residue 199-204
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence GLGGVG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

131) chain B
residue 222-225
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VDIN
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

132) chain B
residue 228
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence K
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

133) chain B
residue 243
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence P
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

134) chain B
residue 268-271
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VIGR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

135) chain B
residue 273-274
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence DT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

136) chain B
residue 292-294
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence VGV
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

137) chain B
residue 317-320
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence AIFG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

138) chain B
residue 362
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence L
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

139) chain B
residue 368-369
type binding
ligand NAJ: NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM)
sequence IR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE (ACIDIC FORM) binding site
source pdb_hetatom : NAJ_6owm_B_403

140) chain A
residue 309
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

141) chain B
residue 46
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence C
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

142) chain B
residue 48
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence S
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

143) chain B
residue 57
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

144) chain B
residue 67
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence H
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

145) chain B
residue 93
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence W
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

146) chain B
residue 116
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence L
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

147) chain B
residue 140-141
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence FL
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

148) chain B
residue 174
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence C
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

149) chain B
residue 294
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence V
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

150) chain B
residue 318
type binding
ligand PFB: 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL
sequence I
description 2,3,4,5,6-PENTAFLUOROBENZYL ALCOHOL binding site
source pdb_hetatom : PFB_6owm_B_404

151) chain A
residue 338-341
type binding
ligand MRD: (4R)-2-METHYLPENTANE-2,4-DIOL
sequence KKFA
description (4R)-2-METHYLPENTANE-2,4-DIOL binding site
source pdb_hetatom : MRD_6owm_A_405

152) chain B
residue 338-341
type binding
ligand MRD: (4R)-2-METHYLPENTANE-2,4-DIOL
sequence KKFA
description (4R)-2-METHYLPENTANE-2,4-DIOL binding site
source pdb_hetatom : MRD_6owm_B_405


Display surface

Download
Links