eF-site ID 6owc-B PDB Code 6owc Chain B click to enlarge Title Mutant estrogen receptor alpha (ERa) Y537S covalently bound to H3B-6545. Classification Transcription/transcription inhibitor Compound Estrogen receptor Source (ESR1_HUMAN) Sequence B:  RSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSE ASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLL ECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKSVE GMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVY TFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQ QHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKSDLLLEML DA Description Functional site 1) chain B residue 476 type sequence H description binding site for residue EDO B 602 source : AC2 2) chain B residue 479 type sequence L description binding site for residue EDO B 602 source : AC2 3) chain B residue 480 type sequence D description binding site for residue EDO B 602 source : AC2 4) chain B residue 346 type sequence L description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 5) chain B residue 347 type sequence T description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 6) chain B residue 350 type sequence A description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 7) chain B residue 353 type sequence E description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 8) chain B residue 387 type sequence L description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 9) chain B residue 388 type sequence M description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 10) chain B residue 391 type sequence L description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 11) chain B residue 394 type sequence R description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 12) chain B residue 404 type sequence F description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 13) chain B residue 421 type sequence M description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 14) chain B residue 424 type sequence I description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 15) chain B residue 425 type sequence F description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 16) chain B residue 428 type sequence L description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 17) chain B residue 521 type sequence G description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 18) chain B residue 525 type sequence L description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 19) chain B residue 528 type sequence M description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 20) chain B residue 529 type sequence K description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 21) chain B residue 531 type sequence K description binding site for Di-peptide ND1 B 601 and CYS B 530 source : AC3 22) chain B residue 537 type MOD_RES sequence S description Phosphotyrosine; by Tyr-kinases => ECO:0000269|PubMed:7539106 source Swiss-Prot : SWS_FT_FI1 23) chain B residue 447 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links