eF-site ID 6ot2-B
PDB Code 6ot2
Chain B

click to enlarge
Title Structure of the TRPV3 K169A sensitized mutant in apo form at 4.1 A resolution
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel subfamily V member 3
Source (TRPV3_HUMAN)
Sequence B:  XXXXXXXXXXXXXXEEQRRKKRRLKKRIFAAVSEGCVEEL
VELLVELQELCRRRVPDFLMHKLTASDTGATCLMKALLNI
NPNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTAL
NIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGF
YFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNI
LHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNN
DGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTD
WAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEM
LTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVS
YYRGWLQLLGRMFVLIWAMCISVKEGIAIFLLSDAWFHFV
FFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYY
TRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVAL
ASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQ
QNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVS
KESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAE
DDFRLCLRINEVKWTEWKTHVSFLN
Description (1)  Transient receptor potential cation channel subfamily V member 3

Display surface

Download
Links