eF-site ID 6ot2-ABCD
PDB Code 6ot2
Chain A, B, C, D
Title Structure of the TRPV3 K169A sensitized mutant in apo form at 4.1 A resolution
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel subfamily V member 3
Source (TRPV3_HUMAN)
Sequence A:  XXXXXXXXXXXXXXEEQRRKKRRLKKRIFAAVSEGCVEEL
VELLVELQELCRRRVPDFLMHKLTASDTGATCLMKALLNI
NPNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTAL
NIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGF
YFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNI
LHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNN
DGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTD
WAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEM
LTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVS
YYRGWLQLLGRMFVLIWAMCISVKEGIAIFLLSDAWFHFV
FFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYY
TRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVAL
ASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQ
QNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVS
KESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAE
DDFRLCLRINEVKWTEWKTHVSFLN
B:  XXXXXXXXXXXXXXEEQRRKKRRLKKRIFAAVSEGCVEEL
VELLVELQELCRRRVPDFLMHKLTASDTGATCLMKALLNI
NPNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTAL
NIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGF
YFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNI
LHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNN
DGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTD
WAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEM
LTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVS
YYRGWLQLLGRMFVLIWAMCISVKEGIAIFLLSDAWFHFV
FFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYY
TRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVAL
ASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQ
QNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVS
KESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAE
DDFRLCLRINEVKWTEWKTHVSFLN
C:  XXXXXXXXXXXXXXEEQRRKKRRLKKRIFAAVSEGCVEEL
VELLVELQELCRRRVPDFLMHKLTASDTGATCLMKALLNI
NPNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTAL
NIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGF
YFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNI
LHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNN
DGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTD
WAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEM
LTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVS
YYRGWLQLLGRMFVLIWAMCISVKEGIAIFLLSDAWFHFV
FFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYY
TRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVAL
ASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQ
QNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVS
KESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAE
DDFRLCLRINEVKWTEWKTHVSFLN
D:  XXXXXXXXXXXXXXEEQRRKKRRLKKRIFAAVSEGCVEEL
VELLVELQELCRRRVPDFLMHKLTASDTGATCLMKALLNI
NPNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTAL
NIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGF
YFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNI
LHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNN
DGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTD
WAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEM
LTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVS
YYRGWLQLLGRMFVLIWAMCISVKEGIAIFLLSDAWFHFV
FFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYY
TRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVAL
ASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQ
QNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVS
KESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAE
DDFRLCLRINEVKWTEWKTHVSFLN
Description (1)  Transient receptor potential cation channel subfamily V member 3

Display surface

Download
Links