eF-site ID 6om4-A
PDB Code 6om4
Chain A

click to enlarge
Title The structure of Microcin C7 biosynthetic enzyme MccB in complex with N-formylated MccA
Classification BIOSYNTHETIC PROTEIN
Compound MccB protein
Source (MCCC7_ECOLX)
Sequence A:  MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIK
TAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIP
SEYNNNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGC
GGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSE
DDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKV
PEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDI
AVFGPLYVPGKTGCYECQKVVADLYGAEKENIDHKIKLIN
SRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRI
GIWSDEIKIHSQNMGRSPVCSVCGN
Description (1)  MccB protein, Microcin C7


Functional site

1) chain A
residue 257
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

2) chain A
residue 260
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

3) chain A
residue 343
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

4) chain A
residue 346
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

5) chain A
residue 154
type
ligand
sequence N
description binding site for residue POP A 403
source : AC3

6) chain A
residue 157
type
ligand
sequence R
description binding site for residue POP A 403
source : AC3

7) chain A
residue 158
type
ligand
sequence Q
description binding site for residue POP A 403
source : AC3

8) chain A
residue 170
type
ligand
sequence K
description binding site for residue POP A 403
source : AC3

9) chain A
residue 94
type
ligand
sequence R
description binding site for residue POP B 404
source : AC8

10) chain A
residue 122
type
ligand
sequence G
description binding site for residue ND7 C 101
source : AC9

11) chain A
residue 124
type
ligand
sequence G
description binding site for residue ND7 C 101
source : AC9

12) chain A
residue 125
type
ligand
sequence G
description binding site for residue ND7 C 101
source : AC9

13) chain A
residue 157
type
ligand
sequence R
description binding site for residue ND7 C 101
source : AC9

14) chain A
residue 158
type
ligand
sequence Q
description binding site for residue ND7 C 101
source : AC9

15) chain A
residue 170
type
ligand
sequence K
description binding site for residue ND7 C 101
source : AC9

16) chain A
residue 192
type
ligand
sequence L
description binding site for residue ND7 C 101
source : AC9

17) chain A
residue 193
type
ligand
sequence N
description binding site for residue ND7 C 101
source : AC9

18) chain A
residue 194
type
ligand
sequence I
description binding site for residue ND7 C 101
source : AC9

19) chain A
residue 212
type
ligand
sequence S
description binding site for residue ND7 C 101
source : AC9

20) chain A
residue 213
type
ligand
sequence A
description binding site for residue ND7 C 101
source : AC9

21) chain A
residue 215
type
ligand
sequence H
description binding site for residue ND7 C 101
source : AC9

22) chain A
residue 239
type
ligand
sequence Y
description binding site for residue ND7 C 101
source : AC9

23) chain A
residue 22-23
type binding
ligand FME: N-FORMYLMETHIONINE
sequence GG
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_D_1

24) chain A
residue 26
type binding
ligand FME: N-FORMYLMETHIONINE
sequence E
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_D_1

25) chain A
residue 94
type binding
ligand POP: PYROPHOSPHATE 2-
sequence R
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_B_404

26) chain A
residue 121-126
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence LGCGGI
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

27) chain A
residue 145-148
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence IDND
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

28) chain A
residue 157-158
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence RQ
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

29) chain A
residue 170
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence K
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

30) chain A
residue 192-195
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence LNIN
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

31) chain A
residue 212-216
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence SADHP
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

32) chain A
residue 219
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence L
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

33) chain A
residue 239
type binding
ligand ND7: 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine
sequence Y
description 5'-O-[(S)-amino(hydroxy)phosphoryl]adenosine binding site
source pdb_hetatom : ND7_6om4_C_101

34) chain A
residue 124-125
type binding
ligand POP: PYROPHOSPHATE 2-
sequence GG
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

35) chain A
residue 148
type binding
ligand POP: PYROPHOSPHATE 2-
sequence D
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

36) chain A
residue 151
type binding
ligand POP: PYROPHOSPHATE 2-
sequence E
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

37) chain A
residue 153-154
type binding
ligand POP: PYROPHOSPHATE 2-
sequence TN
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

38) chain A
residue 157-158
type binding
ligand POP: PYROPHOSPHATE 2-
sequence RQ
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

39) chain A
residue 170
type binding
ligand POP: PYROPHOSPHATE 2-
sequence K
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

40) chain A
residue 287
type binding
ligand POP: PYROPHOSPHATE 2-
sequence K
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

41) chain A
residue 290
type binding
ligand POP: PYROPHOSPHATE 2-
sequence T
description PYROPHOSPHATE 2- binding site
source pdb_hetatom : POP_6om4_A_403

42) chain A
residue 240
type binding
ligand FME: N-FORMYLMETHIONINE
sequence V
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

43) chain A
residue 243
type binding
ligand FME: N-FORMYLMETHIONINE
sequence I
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

44) chain A
residue 245
type binding
ligand FME: N-FORMYLMETHIONINE
sequence V
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

45) chain A
residue 264
type binding
ligand FME: N-FORMYLMETHIONINE
sequence V
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

46) chain A
residue 322-324
type binding
ligand FME: N-FORMYLMETHIONINE
sequence RIG
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

47) chain A
residue 326
type binding
ligand FME: N-FORMYLMETHIONINE
sequence W
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

48) chain A
residue 333
type binding
ligand FME: N-FORMYLMETHIONINE
sequence H
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1

49) chain A
residue 335
type binding
ligand FME: N-FORMYLMETHIONINE
sequence Q
description N-FORMYLMETHIONINE binding site
source pdb_hetatom : FME_6om4_C_1


Display surface

Download
Links