eF-site ID 6oj6-E
PDB Code 6oj6
Chain E

click to enlarge
Title In situ structure of rotavirus VP1 RNA-dependent RNA polymerase (DLP_RNA)
Classification VIRAL PROTEIN/TRANSFERASE/RNA
Compound Inner capsid protein VP2
Source ORGANISM_COMMON: RV-A; ORGANISM_SCIENTIFIC: Rotavirus A (strain RVA/Monkey/United States/RRV/1975/G3P5B[3]);
Sequence E:  VQYEILQKTIPTFEPKESILKKLEDIKPEQVKKQTKLFRI
FEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREY
FLNLYDQVLTEMPDYLLLKDMAVENKNSRDAGKVVDSETA
AICDAIFQDEETEGVVRRFIAEMRQRVQADRNVVNYPSIL
HPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYI
LNMDRNLPSTARYIRPNLLQDRLNLHDNFESLWDTITTSN
YILARSVVPDLKELTGINSQAANDCFKTLIAAMLSQRTMS
LDFVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIIN
TIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQL
SRQQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYN
YETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNL
YQKKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLP
VEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLN
NQPVALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVD
TLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDN
MRIMNEL
Description (1)  Inner capsid protein VP2, RNA-directed RNA polymerase/RNA Complex

Display surface

Download
Links