eF-site ID 6oij-R PDB Code 6oij Chain R click to enlarge Title Muscarinic acetylcholine receptor 1-G11 protein complex Classification SIGNALING PROTEIN Compound Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein subunit alpha-11 Source (GBG2_HUMAN) Sequence R:  PWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNN YFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLW LALDYVASQASVMNLLLISFDRYFSVTRPLSYRAKRTPRR AALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQ FLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARE LAALQGEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLL LCRWDKRRWRKIP Description (1)  Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein subunit alpha-11, Muscarinic acetylcholine receptor M1, Antibody fragment, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 Functional site 1) chain R residue 105 type sequence D description binding site for residue IXO R 501 source : AC1 2) chain R residue 106 type sequence Y description binding site for residue IXO R 501 source : AC1 3) chain R residue 109 type sequence S description binding site for residue IXO R 501 source : AC1 4) chain R residue 110 type sequence Q description binding site for residue IXO R 501 source : AC1 5) chain R residue 196 type sequence A description binding site for residue IXO R 501 source : AC1 6) chain R residue 197 type sequence F description binding site for residue IXO R 501 source : AC1 7) chain R residue 378 type sequence W description binding site for residue IXO R 501 source : AC1 8) chain R residue 404 type sequence Y description binding site for residue IXO R 501 source : AC1 9) chain R residue 407 type sequence C description binding site for residue IXO R 501 source : AC1 10) chain R residue 408 type sequence Y description binding site for residue IXO R 501 source : AC1 11) chain R residue 205 type sequence C description binding site for residue Y01 R 502 source : AC2 12) chain R residue 206 type sequence T description binding site for residue Y01 R 502 source : AC2 13) chain R residue 383 type sequence I description binding site for residue Y01 R 502 source : AC2 14) chain R residue 69 type sequence C description binding site for residue Y01 R 503 source : AC3 15) chain R residue 139 type sequence P description binding site for residue Y01 R 503 source : AC3 16) chain R residue 143 type sequence A description binding site for residue Y01 R 503 source : AC3 17) chain R residue 146 type sequence I description binding site for residue Y01 R 503 source : AC3 18) chain R residue 150 type sequence W description binding site for residue Y01 R 503 source : AC3 19) chain R residue 170 type SITE sequence E description Subtype-specific residue that binds to snake venom muscarinic toxin 7 => ECO:0000269|PubMed:32646996 source Swiss-Prot : SWS_FT_FI10 20) chain R residue 174 type SITE sequence L description Subtype-specific residue that binds to snake venom muscarinic toxin 7 => ECO:0000269|PubMed:32646996 source Swiss-Prot : SWS_FT_FI10 21) chain R residue 397 type SITE sequence E description Subtype-specific residue that binds to snake venom muscarinic toxin 7 => ECO:0000269|PubMed:32646996 source Swiss-Prot : SWS_FT_FI10 22) chain R residue 401 type SITE sequence E description Subtype-specific residue that binds to snake venom muscarinic toxin 7 => ECO:0000269|PubMed:32646996 source Swiss-Prot : SWS_FT_FI10 23) chain R residue 172 type SITE sequence T description Binds to snake venom muscarinic toxin 7 => ECO:0000269|PubMed:32646996 source Swiss-Prot : SWS_FT_FI11 24) chain R residue 85-95 type TOPO_DOM sequence YLLMGHWALGT description Extracellular => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI4 25) chain R residue 165-185 type TOPO_DOM sequence QYLVGERTVLAGQCYIQFLSQ description Extracellular => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI4 26) chain R residue 391-397 type TOPO_DOM sequence CKDCVPE description Extracellular => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI4 27) chain R residue 96-121 type TRANSMEM sequence LACDLWLALDYVASQASVMNLLLISF description Helical; Name=3 => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI5 28) chain R residue 143-164 type TRANSMEM sequence ALMIGLAWLVSFVLWAPAILFW description Helical; Name=4 => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI6 29) chain R residue 186-209 type TRANSMEM sequence PIITFGTAMAAFYLPVTVMCTLYW description Helical; Name=5 => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI7 30) chain R residue 122-142 type MOD_RES sequence DRYFSVTRPLSYRAKRTPRRA description Cysteine methyl ester => ECO:0000250|UniProtKB:P63212 source Swiss-Prot : SWS_FT_FI2 31) chain R residue 428 type MOD_RES sequence T description Phosphothreonine => ECO:0000255 source Swiss-Prot : SWS_FT_FI13 32) chain R residue 111-127 type prosite sequence ASVMNLLLISFDRYFSV description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. ASVmNLLLISFDRYFsV source prosite : PS00237 33) chain R residue 367-390 type TRANSMEM sequence LSAILLAFILTWTPYNIMVLVSTF description Helical; Name=6 => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI8 34) chain R residue 398-420 type TRANSMEM sequence TLWELGYWLCYVNSTINPMCYAL description Helical; Name=7 => ECO:0000269|PubMed:32646996, ECO:0007744|PDB:6WJC source Swiss-Prot : SWS_FT_FI9

Display surface Download Links