eF-site ID 6oh7-A
PDB Code 6oh7
Chain A

click to enlarge
Title Crystal structure of (E)-biformene synthase LrdC from Streptomyces sp. strain K155 in complex with Mg
Classification LYASE
Compound Labdane-related diterpene synthase
Source (A0A158RFK9_STRSQ)
Sequence A:  MLPLPDFTATFPEPFPAGPHSERTEHRLLDWLEEHPLLPS
AKAKAVLVNITSHGASRTFPTADADDLLLFAELLLWLTAF
DDVHAEGNGVGGPAALVDRASELMLVLAGGNPPRAMSPFP
AVLHDLLARFRARASAAAYHRLAASLRDTLMALVWEAHHV
AKPEGVALATYLAMRPHTVFIKTITAAGEILLGYELTDTQ
RALAAVRNLETAVANLAGWINDLASYEREMQRGRGQPLSL
PTLLHARHGGTIEEAFTRASSMCENEAAVARRGITHLAHA
SPNALTAHARALEDITRSFIWHTSHARYQGI
Description (1)  Labdane-related diterpene synthase (E.C.4.2.3.-)


Functional site

1) chain A
residue 116
type
ligand
sequence L
description binding site for residue PEG A 501
source : AC1

2) chain A
residue 117
type
ligand
sequence A
description binding site for residue PEG A 501
source : AC1

3) chain A
residue 149
type
ligand
sequence H
description binding site for residue PEG A 501
source : AC1

4) chain A
residue 152
type
ligand
sequence A
description binding site for residue PEG A 501
source : AC1

5) chain A
residue 156
type
ligand
sequence R
description binding site for residue PEG A 501
source : AC1

6) chain A
residue 181
type
ligand
sequence L
description binding site for residue PEG A 502
source : AC2

7) chain A
residue 185
type
ligand
sequence P
description binding site for residue PEG A 502
source : AC2

8) chain A
residue 191
type
ligand
sequence K
description binding site for residue PEG A 502
source : AC2

9) chain A
residue 220
type
ligand
sequence T
description binding site for residue PEG A 502
source : AC2

10) chain A
residue 224
type
ligand
sequence N
description binding site for residue PEG A 502
source : AC2

11) chain A
residue 19
type
ligand
sequence T
description binding site for residue PEG A 503
source : AC3

12) chain A
residue 20
type
ligand
sequence F
description binding site for residue PEG A 503
source : AC3

13) chain A
residue 21
type
ligand
sequence P
description binding site for residue PEG A 503
source : AC3

14) chain A
residue 280
type
ligand
sequence R
description binding site for residue PEG A 503
source : AC3

15) chain A
residue 306
type
ligand
sequence R
description binding site for residue PEG A 503
source : AC3

16) chain A
residue 90
type
ligand
sequence D
description binding site for residue MG A 504
source : AC4

17) chain A
residue 95
type
ligand
sequence E
description binding site for residue MG A 504
source : AC4

18) chain A
residue 40
type
ligand
sequence W
description binding site for residue GOL A 505
source : AC5

19) chain A
residue 43
type
ligand
sequence E
description binding site for residue GOL A 505
source : AC5

20) chain A
residue 44
type
ligand
sequence H
description binding site for residue GOL A 505
source : AC5

21) chain A
residue 131
type
ligand
sequence V
description binding site for residue GOL A 505
source : AC5

22) chain A
residue 134
type
ligand
sequence D
description binding site for residue GOL A 505
source : AC5

23) chain A
residue 138
type
ligand
sequence R
description binding site for residue GOL A 505
source : AC5

24) chain A
residue 120
type
ligand
sequence N
description binding site for residue GOL A 506
source : AC6

25) chain A
residue 121
type
ligand
sequence P
description binding site for residue GOL A 506
source : AC6

26) chain A
residue 122
type
ligand
sequence P
description binding site for residue GOL A 506
source : AC6

27) chain A
residue 129
type
ligand
sequence P
description binding site for residue GOL A 506
source : AC6

28) chain A
residue 133
type
ligand
sequence H
description binding site for residue GOL A 506
source : AC6

29) chain A
residue 54
type
ligand
sequence A
description binding site for residue GOL A 507
source : AC7

30) chain A
residue 55
type
ligand
sequence V
description binding site for residue GOL A 507
source : AC7

31) chain A
residue 58
type
ligand
sequence N
description binding site for residue GOL A 507
source : AC7

32) chain A
residue 263
type
ligand
sequence E
description binding site for residue GOL A 507
source : AC7

33) chain A
residue 18-21
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence ATFP
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_503

34) chain A
residue 24
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence F
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_503

35) chain A
residue 280
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_503

36) chain A
residue 302
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence E
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_503

37) chain A
residue 306
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_503

38) chain A
residue 40
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

39) chain A
residue 43-44
type binding
ligand GOL: GLYCEROL
sequence EH
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

40) chain A
residue 81
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

41) chain A
residue 131
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

42) chain A
residue 134-135
type binding
ligand GOL: GLYCEROL
sequence DL
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

43) chain A
residue 138
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_505

44) chain A
residue 51
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_507

45) chain A
residue 54-55
type binding
ligand GOL: GLYCEROL
sequence AV
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_507

46) chain A
residue 58
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_507

47) chain A
residue 314-315
type binding
ligand GOL: GLYCEROL
sequence HA
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_507

48) chain A
residue 115
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_506

49) chain A
residue 120-124
type binding
ligand GOL: GLYCEROL
sequence NPPRA
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_506

50) chain A
residue 129-130
type binding
ligand GOL: GLYCEROL
sequence PA
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_506

51) chain A
residue 133
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_6oh7_A_506

52) chain A
residue 116-118
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence LAG
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_501

53) chain A
residue 148-149
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence YH
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_501

54) chain A
residue 152
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence A
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_501

55) chain A
residue 156
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_501

56) chain A
residue 181-182
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence LA
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_502

57) chain A
residue 185
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence P
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_502

58) chain A
residue 191
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence K
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_502

59) chain A
residue 220
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence T
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_502

60) chain A
residue 223-224
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence AN
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6oh7_A_502


Display surface

Download
Links