eF-site ID 6ogz-K
PDB Code 6ogz
Chain K

click to enlarge
Title In situ structure of Rotavirus RNA-dependent RNA polymerase at transcript-elongated state
Classification viral protein/rna/transferase
Compound RNA (5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*A)-3')
Source ORGANISM_SCIENTIFIC: Rotavirus A;
Sequence K:  PKESILKKLEDIKPEQVKKQTKLFRIFEPRQLPVYRANGE
KELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQVLTEMPD
YLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEG
VVRRFIAEMRQRVQADRNVVNYPSILHPIDHAFNEYFLQH
QLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPSTARYI
RPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKEL
VSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQAANDCF
KTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTVVPNDMF
IRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIA
EQQIQNFQVANWLHFVNNNQFRQVVIDGVLNQVLNDNIRN
GHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGILLLSNR
LGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLT
SVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNYNERIN
DAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFDISRVPD
DQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKI
AQGVIIAYRDMQLERDEMYGYVNIARNLDGFQQINLEELM
RTGDYAQITNMLLNNQPVALVGALPFITDSSVISLVAKLD
ATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVP
TSTTKVYKQIPQQFDFRASMHMLTSNLTFTVYSDLLAFVS
ADTVEPINAVAFDNMRIMNEL
Description (1)  RNA-dependent RNA polymerase of rotavirus A, Inner capsid protein VP2/RNA Complex

Display surface

Download
Links