eF-site ID 6ogz-AEFGHIJKLMN
PDB Code 6ogz
Chain A, E, F, G, H, I, J, K, L, M, N
Title In situ structure of Rotavirus RNA-dependent RNA polymerase at transcript-elongated state
Classification viral protein/rna/transferase
Compound RNA (5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*A)-3')
Source ORGANISM_SCIENTIFIC: Rotavirus A;
Sequence A:  GKYNLILSEYLSFIYNSQSAVQIPIYYSSNSELENRCIEF
HSKCLENSKNGLSLKKLFVEYSDVIENATLLSILSYSYDK
YNAVERKLVKYAKGKPLEADLTVNELDYENNKITSELFPT
AEEYTDLLMDPAILTSLSSNLNAVMFWLEKHENDVAEKLK
IYKRRLDLFTIVASTVNKYGVPRHNAKYRYEYEVMKDKPY
YLVTWANSSIEMLMSVFSHEDYLIARELIVLSYSNRSTLA
KLVSSPMSILVALVDINGTFITNEELELEFSNKYVRAIVP
DQTFDELKQMLDNMRKAGLTDIPKMIQDWLVDCSIEKFPL
MAKIYSWSFHVGFRKQKMLDAALDQLKTEYTEDVDDEMYR
EYTMLIRDEVVKMLEEPVKHDDHLLQDSELAGLLSMSSAS
NGESRQLKFGRKTIFSTKKNMHVMDDMANGRYTPGIIPPV
NVDKPIPLGRRDVPGRRTRIIFILPYEYFIAQHAVVEKML
IYAKHTREYAEFYSQSNQLLSYGDVTRFLSNNSMVLYTDV
SQWDSSQHNTQPFRKGIIMGLDMLANMTNDARVIQTLNLY
KQTQINLMDSYVQIPDGNVIKKIQYGAVASGEKQTKAANS
IANLALIKTVLSRISNKYSFATKIIRVDGDDNYAVLQFNT
EVTKQMVQDVSNDVRETYARMNTKVKALVSTVGIEIAKRY
IAGGKIFFRAGINLLNNEKKGQSTQWDQAAVLYSNYIVNR
LRGFETDREFILTKIMQMTSVAITGSLRLFPSERVLTTNS
TFKVFDSEDFIIEYGTTDDEVYIQRAFMSLSSQKSGIADE
IAASSTFKNYVSRLSEQLLFSKNNIVSRGIALTEKAKLNS
YAPISLEKRRAQISALLTMLQKPVTFKSSKITINDILRDI
KPFFTVNEAHLPIQYQKFMPTLPDNVQYIIQCIGSRTYQI
EDDGSKSAISRLISKYSVYKPSIEELYKVISLHENEIQLY
LISLGIPKIDADTYVGSKIYSQDKYRILESYVYNLLSINY
GCYQLFDFNSPDLEKLIRIPFKGKIPAVTFILHLYAKLEV
INHAIKNGSWISLFCNYPKSEMIKLWKKMWNITSLRSPYT
NA
E:  QYEILQKTIPTFEPKESILKKLEDIKPEQVKKQTKLFRIF
EPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYF
LNLYDQVLTEMPDYLLLKDMAVENKNSRDAGKVVDSETAA
ICDAIFQDEETEGVVRRFIAEMRQRVQADRNVVNYPSILH
PIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYIL
NMDRNLPSTARYIRPNLLQDRLNLHDNFESLWDTITTSNY
ILARSVVPDLKELVSTEAQIQKMSQDLQLEALTIQSETQF
LTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLIS
GMWLLTVVPNDMFIRESLVACQLAIINTIIYPAFGMQRMH
YRNGDPQTPFQIAEQQIQNFQVANWLHFVNNNQFRQVVID
GVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYK
RSIQRGILLLSNRLGQLVDLTRLLAYNYETLMACITMNMQ
HVQTLTTEKLQLTSVTSLCMLIGNATVIPSPQTLFHYYNV
NVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFL
KRLQIFDISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLIL
MNMEQIERASDKIAQGVIIAYRDMQLERDEMYGYVNIARN
LDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFI
TDSSVISLVAKLDATVFAQIVKLRKVDTLKPILYKINSDS
NDFYLVANYDWVPTSTTKVYKQIPQQFDFRASMHMLTSNL
TFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
F:  TKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKPEQVK
KQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPD
GDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRDAG
KVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQADRN
VVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPER
IRNDVNYILNMDRNLPSTARYIRPNLLQDRLNLHDNFESL
WDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQLEA
LTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFV
TTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTIIY
PAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFVNN
NQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQ
FPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYNYETL
MACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIPSP
QTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKK
MKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVEIR
RLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLERDEM
YGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPV
ALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVDTLKP
ILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDFRA
SMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIM
NEL
G:  NKEESKQLLEVLKPKESILKKLEDIKPEQVKKQTKLFRIF
EPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYF
LNLYDQVLTEMPDYLLLKDMAVENKNSRDAGKVVDSETAA
ICDAIFQDEETEGVVRRFIAEMRQRVQADRNVVNYPSILH
PIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYIL
NMDRNLPSTARYIRPNLLQDRLNLHDNFESLWDTITTSNY
ILARSVVPDLKELVSTEAQIQKMSQDLQLEALTIQSETQF
LTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLIS
GMWLLTVVPNDMFIRESLVACQLAIINTIIYPAFGMQRMH
YRNGDPQTPFQIAEQQIQNFQVANWLHFVNNNQFRQVVID
GVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYK
RSIQRGILLLSNRLGQLVDLTRLLAYNYETLMACITMNMQ
HVQTLTTEKLQLTSVTSLCMLIGNATVIPSPQTLFHYYNV
NVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFL
KRLQIFDISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLIL
MNMEQIERASDKIAQGVIIAYRDMQLERDEMYGYVNIARN
LDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFI
TDSSVISLVAKLDATVFAQIVKLRKVDTLKPILYKINSDS
NDFYLVANYDWVPTSTTKVYKQIPQQFDFRASMHMLTSNL
TFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
H:  LKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKPEQ
VKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTL
PDGDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRD
AGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQAD
RNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIP
ERIRNDVNYILNMDRNLPSTARYIRPNLLQDRLNLHDNFE
SLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQL
EALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLD
FVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTI
IYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFV
NNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSR
QQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYNYE
TLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIP
SPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQ
KKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVE
IRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLERD
EMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQ
PVALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVDTL
KPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDF
RASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMR
IMNEL
I:  PKESILKKLEDIKPEQVKKQTKLFRIFEPRQLPVYRANGE
KELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQVLTEMPD
YLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEG
VVRRFIAEMRQRVQADRNVVNYPSILHPIDHAFNEYFLQH
QLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPSTARYI
RPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKEL
VSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQAANDCF
KTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTVVPNDMF
IRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIA
EQQIQNFQVANWLHFVNNNQFRQVVIDGVLNQVLNDNIRN
GHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGILLLSNR
LGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLT
SVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNYNERIN
DAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFDISRVPD
DQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKI
AQGVIIAYRDMQLERDEMYGYVNIARNLDGFQQINLEELM
RTGDYAQITNMLLNNQPVALVGALPFITDSSVISLVAKLD
ATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVP
TSTTKVYKQIPQQFDFRASMHMLTSNLTFTVYSDLLAFVS
ADTVEPINAVAFDNMRIMNEL
J:  LKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKPEQ
VKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTL
PDGDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRD
AGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQAD
RNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIP
ERIRNDVNYILNMDRNLPSTARYIRPNLLQDRLNLHDNFE
SLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQL
EALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLD
FVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTI
IYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFV
NNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSR
QQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYNYE
TLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIP
SPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQ
KKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVE
IRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLERD
EMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQ
PVALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVDTL
KPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDF
RASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMR
IMNEL
K:  PKESILKKLEDIKPEQVKKQTKLFRIFEPRQLPVYRANGE
KELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQVLTEMPD
YLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEG
VVRRFIAEMRQRVQADRNVVNYPSILHPIDHAFNEYFLQH
QLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPSTARYI
RPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKEL
VSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQAANDCF
KTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTVVPNDMF
IRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIA
EQQIQNFQVANWLHFVNNNQFRQVVIDGVLNQVLNDNIRN
GHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGILLLSNR
LGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLT
SVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNYNERIN
DAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFDISRVPD
DQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKI
AQGVIIAYRDMQLERDEMYGYVNIARNLDGFQQINLEELM
RTGDYAQITNMLLNNQPVALVGALPFITDSSVISLVAKLD
ATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVP
TSTTKVYKQIPQQFDFRASMHMLTSNLTFTVYSDLLAFVS
ADTVEPINAVAFDNMRIMNEL
L:  LKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKPEQ
VKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTL
PDGDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRD
AGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQAD
RNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIP
ERIRNDVNYILNMDRNLPSTARYIRPNLLQDRLNLHDNFE
SLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQL
EALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLD
FVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTI
IYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFV
NNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSR
QQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYNYE
TLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIP
SPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQ
KKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVE
IRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLERD
EMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQ
PVALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVDTL
KPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDF
RASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMR
IMNEL
M:  IKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKT
IPTFEPKESILKKLEDIKPEQVKKQTKLFRIFEPRQLPVY
RANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQVL
TEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQD
EETEGVVRRFIAEMRQRVQADRNVVNYPSILHPIDHAFNE
YFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPS
TARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVP
DLKELVSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQA
ANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTVV
PNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQT
PFQIAEQQIQNFQVANWLHFVNNNQFRQVVIDGVLNQVLN
DNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGIL
LLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTE
KLQLTSVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNY
NERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFDI
SRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIER
ASDKIAQGVIIAYRDMQLERDEMYGYVNIARNLDGFQQIN
LEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVISL
VAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVAN
YDWVPTSTTKVYKQIPQQFDFRASMHMLTSNLTFTVYSDL
LAFVSADTVEPINAVAFDNMRIMNEL
N:  LKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKPEQ
VKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTL
PDGDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRD
AGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQAD
RNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIP
ERIRNDVNYILNMDRNLPSTARYIRPNLLQDRLNLHDNFE
SLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQL
EALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLD
FVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTI
IYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFV
NNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSR
QQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLLAYNYE
TLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIP
SPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQ
KKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVE
IRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLERD
EMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQ
PVALVGALPFITDSSVISLVAKLDATVFAQIVKLRKVDTL
KPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDF
RASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMR
IMNEL
Description (1)  RNA-dependent RNA polymerase of rotavirus A, Inner capsid protein VP2/RNA Complex


Functional site

1) chain A
residue 452
type
ligand
sequence R
description binding site for residue UTP A 1101
source : AC1

2) chain A
residue 457
type
ligand
sequence R
description binding site for residue UTP A 1101
source : AC1

3) chain A
residue 460
type
ligand
sequence R
description binding site for residue UTP A 1101
source : AC1

4) chain A
residue 520
type
ligand
sequence D
description binding site for residue UTP A 1101
source : AC1

5) chain A
residue 521
type
ligand
sequence V
description binding site for residue UTP A 1101
source : AC1

6) chain A
residue 522
type
ligand
sequence S
description binding site for residue UTP A 1101
source : AC1

7) chain A
residue 523
type
ligand
sequence Q
description binding site for residue UTP A 1101
source : AC1

8) chain A
residue 524
type
ligand
sequence W
description binding site for residue UTP A 1101
source : AC1

9) chain A
residue 525
type
ligand
sequence D
description binding site for residue UTP A 1101
source : AC1

10) chain A
residue 591
type
ligand
sequence S
description binding site for residue UTP A 1101
source : AC1

11) chain A
residue 596
type
ligand
sequence T
description binding site for residue UTP A 1101
source : AC1

12) chain A
residue 600
type
ligand
sequence N
description binding site for residue UTP A 1101
source : AC1

13) chain A
residue 631
type
ligand
sequence D
description binding site for residue UTP A 1101
source : AC1

14) chain A
residue 632
type
ligand
sequence D
description binding site for residue UTP A 1101
source : AC1

15) chain A
residue 11
type
ligand
sequence Y
description binding site for residue GTP A 1102
source : AC2

16) chain A
residue 83
type
ligand
sequence N
description binding site for residue GTP A 1102
source : AC2

17) chain A
residue 143
type
ligand
sequence N
description binding site for residue GTP A 1102
source : AC2

18) chain A
residue 184
type
ligand
sequence R
description binding site for residue GTP A 1102
source : AC2

19) chain A
residue 185
type
ligand
sequence H
description binding site for residue GTP A 1102
source : AC2

20) chain A
residue 189
type
ligand
sequence Y
description binding site for residue GTP A 1102
source : AC2

21) chain A
residue 749
type
ligand
sequence R
description binding site for residue GTP A 1102
source : AC2

22) chain A
residue 452
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence R
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

23) chain A
residue 457-458
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence RR
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

24) chain A
residue 460
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence R
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

25) chain A
residue 462
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence I
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

26) chain A
residue 520-525
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence DVSQWD
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

27) chain A
residue 591-592
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence SG
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

28) chain A
residue 596
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence T
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

29) chain A
residue 600
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence N
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

30) chain A
residue 631-632
type binding
ligand UTP: URIDINE 5'-TRIPHOSPHATE
sequence DD
description URIDINE 5'-TRIPHOSPHATE binding site
source pdb_hetatom : UTP_6ogz_A_1101

31) chain A
residue 11
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence Y
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

32) chain A
residue 15
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence I
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

33) chain A
residue 80-81
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence DK
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

34) chain A
residue 83
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence N
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

35) chain A
residue 85
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence V
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

36) chain A
residue 137
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence S
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

37) chain A
residue 139-140
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence SS
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

38) chain A
residue 143
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence N
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

39) chain A
residue 184-186
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence RHN
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

40) chain A
residue 189
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence Y
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

41) chain A
residue 738
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence Q
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102

42) chain A
residue 749
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence R
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_6ogz_A_1102


Display surface

Download
Links