eF-site ID 6ogz-A PDB Code 6ogz Chain A click to enlarge Title In situ structure of Rotavirus RNA-dependent RNA polymerase at transcript-elongated state Classification viral protein/rna/transferase Compound RNA (5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*A)-3') Source ORGANISM_SCIENTIFIC: Rotavirus A; Sequence A:  GKYNLILSEYLSFIYNSQSAVQIPIYYSSNSELENRCIEF HSKCLENSKNGLSLKKLFVEYSDVIENATLLSILSYSYDK YNAVERKLVKYAKGKPLEADLTVNELDYENNKITSELFPT AEEYTDLLMDPAILTSLSSNLNAVMFWLEKHENDVAEKLK IYKRRLDLFTIVASTVNKYGVPRHNAKYRYEYEVMKDKPY YLVTWANSSIEMLMSVFSHEDYLIARELIVLSYSNRSTLA KLVSSPMSILVALVDINGTFITNEELELEFSNKYVRAIVP DQTFDELKQMLDNMRKAGLTDIPKMIQDWLVDCSIEKFPL MAKIYSWSFHVGFRKQKMLDAALDQLKTEYTEDVDDEMYR EYTMLIRDEVVKMLEEPVKHDDHLLQDSELAGLLSMSSAS NGESRQLKFGRKTIFSTKKNMHVMDDMANGRYTPGIIPPV NVDKPIPLGRRDVPGRRTRIIFILPYEYFIAQHAVVEKML IYAKHTREYAEFYSQSNQLLSYGDVTRFLSNNSMVLYTDV SQWDSSQHNTQPFRKGIIMGLDMLANMTNDARVIQTLNLY KQTQINLMDSYVQIPDGNVIKKIQYGAVASGEKQTKAANS IANLALIKTVLSRISNKYSFATKIIRVDGDDNYAVLQFNT EVTKQMVQDVSNDVRETYARMNTKVKALVSTVGIEIAKRY IAGGKIFFRAGINLLNNEKKGQSTQWDQAAVLYSNYIVNR LRGFETDREFILTKIMQMTSVAITGSLRLFPSERVLTTNS TFKVFDSEDFIIEYGTTDDEVYIQRAFMSLSSQKSGIADE IAASSTFKNYVSRLSEQLLFSKNNIVSRGIALTEKAKLNS YAPISLEKRRAQISALLTMLQKPVTFKSSKITINDILRDI KPFFTVNEAHLPIQYQKFMPTLPDNVQYIIQCIGSRTYQI EDDGSKSAISRLISKYSVYKPSIEELYKVISLHENEIQLY LISLGIPKIDADTYVGSKIYSQDKYRILESYVYNLLSINY GCYQLFDFNSPDLEKLIRIPFKGKIPAVTFILHLYAKLEV INHAIKNGSWISLFCNYPKSEMIKLWKKMWNITSLRSPYT NA Description Functional site 1) chain A residue 452 type sequence R description binding site for residue UTP A 1101 source : AC1 2) chain A residue 457 type sequence R description binding site for residue UTP A 1101 source : AC1 3) chain A residue 460 type sequence R description binding site for residue UTP A 1101 source : AC1 4) chain A residue 520 type sequence D description binding site for residue UTP A 1101 source : AC1 5) chain A residue 521 type sequence V description binding site for residue UTP A 1101 source : AC1 6) chain A residue 522 type sequence S description binding site for residue UTP A 1101 source : AC1 7) chain A residue 523 type sequence Q description binding site for residue UTP A 1101 source : AC1 8) chain A residue 524 type sequence W description binding site for residue UTP A 1101 source : AC1 9) chain A residue 525 type sequence D description binding site for residue UTP A 1101 source : AC1 10) chain A residue 591 type sequence S description binding site for residue UTP A 1101 source : AC1 11) chain A residue 596 type sequence T description binding site for residue UTP A 1101 source : AC1 12) chain A residue 600 type sequence N description binding site for residue UTP A 1101 source : AC1 13) chain A residue 631 type sequence D description binding site for residue UTP A 1101 source : AC1 14) chain A residue 632 type sequence D description binding site for residue UTP A 1101 source : AC1 15) chain A residue 11 type sequence Y description binding site for residue GTP A 1102 source : AC2 16) chain A residue 83 type sequence N description binding site for residue GTP A 1102 source : AC2 17) chain A residue 143 type sequence N description binding site for residue GTP A 1102 source : AC2 18) chain A residue 184 type sequence R description binding site for residue GTP A 1102 source : AC2 19) chain A residue 185 type sequence H description binding site for residue GTP A 1102 source : AC2 20) chain A residue 189 type sequence Y description binding site for residue GTP A 1102 source : AC2 21) chain A residue 749 type sequence R description binding site for residue GTP A 1102 source : AC2

Display surface Download Links