eF-site ID 6o8b-A PDB Code 6o8b Chain A click to enlarge Title Crystal structure of STING CTD in complex with TBK1 Classification IMMUNE SYSTEM Compound Stimulator of interferon genes protein Source (TBK1_HUMAN) Sequence A:  PGLDGICQSTSNHLWLLSDILGQGATANVFRGRHKKTGDL FAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIE EETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLI VLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYK LTDFGAARELEDDEQFVELYGTEEYLHPDMYERAVLRKDH QKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVM YKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQ VLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVF SLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIY EGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLDTIGLIY EKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLL YQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRN IEKTVKVYEKLAAELGEISDIHTKLLRLSSSQGTIETSLQ DIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT EIYYQFKKDQAERRLAYNEEQIHKFDKQKLYYHATKAMTH FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDI EEEVSKYQEYTNELQE Description Functional site 1) chain A residue 15 type sequence L description binding site for residue BX7 A 701 source : AC1 2) chain A residue 17 type sequence Q description binding site for residue BX7 A 701 source : AC1 3) chain A residue 36 type sequence A description binding site for residue BX7 A 701 source : AC1 4) chain A residue 38 type sequence K description binding site for residue BX7 A 701 source : AC1 5) chain A residue 86 type sequence M description binding site for residue BX7 A 701 source : AC1 6) chain A residue 87 type sequence E description binding site for residue BX7 A 701 source : AC1 7) chain A residue 88 type sequence F description binding site for residue BX7 A 701 source : AC1 8) chain A residue 89 type sequence C description binding site for residue BX7 A 701 source : AC1 9) chain A residue 92 type sequence G description binding site for residue BX7 A 701 source : AC1 10) chain A residue 93 type sequence S description binding site for residue BX7 A 701 source : AC1 11) chain A residue 96 type sequence T description binding site for residue BX7 A 701 source : AC1 12) chain A residue 139 type sequence G description binding site for residue BX7 A 701 source : AC1 13) chain A residue 142 type sequence M description binding site for residue BX7 A 701 source : AC1 14) chain A residue 156 type sequence T description binding site for residue BX7 A 701 source : AC1 15) chain A residue 135 type ACT_SITE sequence N description Proton acceptor => ECO:0000305|PubMed:23453971, ECO:0000305|PubMed:23453972, ECO:0000305|PubMed:30842653 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 15 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 38 type BINDING sequence K description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 18) chain A residue 30 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23453971 source Swiss-Prot : SWS_FT_FI5 19) chain A residue 401 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23453971 source Swiss-Prot : SWS_FT_FI5 20) chain A residue 15-38 type prosite sequence LGQGATANVFRGRHKKTGDLFAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGQGATANVFrGrhkktgdl..........FAIK source prosite : PS00107 21) chain A residue 172 type MOD_RES sequence E description Phosphoserine; by autocatalysis and IKKB => ECO:0000269|PubMed:11839743, ECO:0000269|PubMed:22851595, ECO:0000269|PubMed:23746807 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links