eF-site ID 6o5c-AB PDB Code 6o5c Chain A, B click to enlarge Title X-ray crystal structure of metal-dependent transcriptional regulator MtsR Classification DNA BINDING PROTEIN Compound Putative metal-dependent transcriptional regulator Source (A0A0H2UTK0_STRP3) Sequence A:  MTPNKEDYLKCIYEIGEQEPKITNKMVAEKMHVSAPAVSE MIKKMISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIE VFLIHQLGYNTQEVHQEAEVLEHTVSDTFIDRLDKILDFP DFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHD HFDLIQYLETHHLNINTELTLTQIDTFAKTYTICYGDKEL VIPENIAKQLYVTAL B:  EDYLKCIYEIGEQETNKMVAEKMHVSAPAVSEMIKKMISQ GWDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNT QEVHQEAEVLEHTVSDTFIDRLDKILDFPDFCPHGGTIPR YGQPLVEMNTTTLNTITELGRFRLSRIHDHFDLIQYLETH HLNINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLY VTAL Description Functional site 1) chain A residue 80 type sequence E description binding site for residue MN A 302 source : AC1 2) chain A residue 123 type sequence C description binding site for residue MN A 302 source : AC1 3) chain A residue 125 type sequence H description binding site for residue MN A 302 source : AC1 4) chain A residue 160 type sequence D description binding site for residue MN A 302 source : AC1 5) chain A residue 13 type sequence Y description binding site for residue PEG A 303 source : AC2 6) chain A residue 66 type sequence Y description binding site for residue PEG A 303 source : AC2 7) chain B residue 80 type sequence E description binding site for residue MN B 301 source : AC3 8) chain B residue 123 type sequence C description binding site for residue MN B 301 source : AC3 9) chain B residue 125 type sequence H description binding site for residue MN B 301 source : AC3 10) chain B residue 160 type sequence D description binding site for residue MN B 301 source : AC3 11) chain B residue 95 type sequence H description binding site for residue MN B 302 source : AC4 12) chain B residue 162 type sequence F description binding site for residue MN B 302 source : AC4

Display surface Download Links