eF-site ID 6o1d-H PDB Code 6o1d Chain H click to enlarge Title Cryo-EM structure of the centromeric nucleosome with native alpha satellite DNA Classification NUCLEAR PROTEIN Compound Histone H3-like centromeric protein A Source (6O1D) Sequence H:  RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSA Description Functional site 1) chain H residue 86 type CROSSLNK sequence R description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25218447 source Swiss-Prot : SWS_FT_FI14 2) chain H residue 92 type CROSSLNK sequence R description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25218447 source Swiss-Prot : SWS_FT_FI14 3) chain H residue 120 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:16627869, ECO:0000269|PubMed:16713563 source Swiss-Prot : SWS_FT_FI18 4) chain H residue 34 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:21726816 source Swiss-Prot : SWS_FT_FI20 5) chain H residue 116 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 6) chain H residue 120 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 7) chain H residue 34 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 8) chain H residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 9) chain H residue 108 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 10) chain H residue 43 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3 11) chain H residue 85 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links