eF-site ID 6o1d-G PDB Code 6o1d Chain G click to enlarge Title Cryo-EM structure of the centromeric nucleosome with native alpha satellite DNA Classification NUCLEAR PROTEIN Compound Histone H3-like centromeric protein A Source (6O1D) Sequence G:  KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAP VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIR NDEELNKLLGRVTIAQGGVLPNIQAVLL Description Functional site 1) chain G residue 9 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 2) chain G residue 95 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 3) chain G residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI13 4) chain G residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 5) chain G residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 6) chain G residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 7) chain G residue 13 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 8) chain G residue 36 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 9) chain G residue 13 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11

Display surface Download Links