eF-site ID 6o1d-B PDB Code 6o1d Chain B click to enlarge Title Cryo-EM structure of the centromeric nucleosome with native alpha satellite DNA Classification NUCLEAR PROTEIN Compound Histone H3-like centromeric protein A Source (6O1D) Sequence B:  RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFL ENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Description Functional site 1) chain B residue 44 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 2) chain B residue 91 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 3) chain B residue 77 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 4) chain B residue 80 type CROSSLNK sequence T description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:15386022, ECO:0000269|PubMed:16359901, ECO:0000269|PubMed:16702407, ECO:0000269|PubMed:25470042 source Swiss-Prot : SWS_FT_FI12 5) chain B residue 79 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 6) chain B residue 59 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 7) chain B residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 8) chain B residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15

Display surface Download Links