eF-site ID 6o1d-ABCDEFGHIJ PDB Code 6o1d Chain A, B, C, D, E, F, G, H, I, J click to enlarge Title Cryo-EM structure of the centromeric nucleosome with native alpha satellite DNA Classification NUCLEAR PROTEIN Compound Histone H3-like centromeric protein A Source (6O1D) Sequence A:  RRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRG VDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTL FPKDVQLARRIRGLEEGLG B:  RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFL ENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG C:  ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPV YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRN DEELNKLLGRVTIAQGGVLPNIQAVLL D:  RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSA E:  RRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRG VDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTL FPKDVQLARRIRGLEEGLG F:  RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFL ENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG G:  KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAP VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIR NDEELNKLLGRVTIAQGGVLPNIQAVLL H:  RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSA I:  ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGG AAACTGCTCCATCAAAAGGCATGTTCAGCTCTGTGAGTGA AACTCCATCATCACAAAGAATATTCTGAGAATGCTTCCGT TTGCCTTTTATATGAACTTCCTGAT J:  ATCAGGAAGTTCATATAAAAGGCAAACGGAAGCATTCTCA GAATATTCTTTGTGATGATGGAGTTTCACTCACAGAGCTG AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTG GTAGAATCTGCAGGTGGATATTGAT Description Functional site 1) chain A residue 66-74 type prosite sequence PFSRLAREI description HISTONE_H3_2 Histone H3 signature 2. PFsRLAREI source prosite : PS00959 2) chain C residue 95 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 3) chain G residue 9 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 4) chain G residue 95 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 5) chain H residue 86 type CROSSLNK sequence R description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25218447 source Swiss-Prot : SWS_FT_FI14 6) chain H residue 92 type CROSSLNK sequence R description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25218447 source Swiss-Prot : SWS_FT_FI14 7) chain G residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI13 8) chain C residue 15 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI13 9) chain C residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 10) chain C residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 11) chain G residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 12) chain G residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 13) chain D residue 120 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:16627869, ECO:0000269|PubMed:16713563 source Swiss-Prot : SWS_FT_FI18 14) chain H residue 120 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:16627869, ECO:0000269|PubMed:16713563 source Swiss-Prot : SWS_FT_FI18 15) chain D residue 34 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:21726816 source Swiss-Prot : SWS_FT_FI20 16) chain H residue 34 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:21726816 source Swiss-Prot : SWS_FT_FI20 17) chain D residue 92-114 type prosite sequence REIQTAVRLLLPGELAKHAVSEG description HISTONE_H2B Histone H2B signature. REIQTavRlLLpGELaKHAVSEG source prosite : PS00357 18) chain C residue 21-27 type prosite sequence AGLQFPV description HISTONE_H2A Histone H2A signature. AGLqFPV source prosite : PS00046 19) chain H residue 116 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 20) chain H residue 120 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 21) chain D residue 120 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 22) chain H residue 34 type MOD_RES sequence K description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 23) chain C residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 24) chain G residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000269|PubMed:24352239 source Swiss-Prot : SWS_FT_FI8 25) chain G residue 13 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 26) chain B residue 44 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 27) chain F residue 44 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 28) chain C residue 13 type MOD_RES sequence K description N6-(beta-hydroxybutyryl)lysine; alternate => ECO:0000269|PubMed:27105115 source Swiss-Prot : SWS_FT_FI5 29) chain G residue 36 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 30) chain B residue 91 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 31) chain F residue 31 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 32) chain B residue 77 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 33) chain C residue 36 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 34) chain F residue 77 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 35) chain F residue 91 type MOD_RES sequence K description N6-crotonyllysine; alternate => ECO:0000269|PubMed:21925322 source Swiss-Prot : SWS_FT_FI6 36) chain H residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 37) chain H residue 108 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 38) chain C residue 13 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 39) chain G residue 13 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:22713238, ECO:0000269|PubMed:22980979 source Swiss-Prot : SWS_FT_FI11 40) chain B residue 80 type CROSSLNK sequence T description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:15386022, ECO:0000269|PubMed:16359901, ECO:0000269|PubMed:16702407, ECO:0000269|PubMed:25470042 source Swiss-Prot : SWS_FT_FI12 41) chain H residue 43 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3 42) chain H residue 85 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3 43) chain D residue 43 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3 44) chain D residue 85 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:C0HKE1 source Swiss-Prot : SWS_FT_FI3 45) chain B residue 79 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 46) chain F residue 59 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 47) chain F residue 79 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 48) chain B residue 59 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 49) chain F residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 50) chain B residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 51) chain D residue 115 type CROSSLNK sequence T description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15 52) chain F residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15 53) chain B residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15

Display surface Download Links