eF-site ID 6o16-AB
PDB Code 6o16
Chain A, B

click to enlarge
Title Crystal structure of murine DHX37 in complex with RNA
Classification HYDROLASE/RNA
Compound DEAH (Asp-Glu-Ala-His) box polypeptide 37
Source (6O16)
Sequence A:  VFIPVNRTPEMQEERLKLPILAEEQAIMEAVAEHPIVIVC
GETGSGKTTQVPQFLYEAGYSSEDSIIGVTEPRRVAAVAM
SQRVAKEMNLSHRVVSYQIRYEGNVTEETRIKFMTDGVLL
KEIQKDFLLLKYKVVIIDEAHERSVYTDILLGLLSRIVAL
RAKRHLPLKLLIMSATLRVEDFTQNQRLFTTPPPVIKVES
RFPVTVHFNDDYSGECFRKVCKIHRMLPAGGILVFLTGQA
EVHALCRRLRKAFLPLHVLPLYSLLAPEKQAQVFKPPPGT
RLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVS
SFRVTWVSQASADQRAGRAGRTEPGHCYRLYSSAVFGDFE
QFPPPEITRRPVEDLILQMKALSIEKVINFPFPTPPSVEA
LVAAEELLVALGALQAQLSCPITALGRTMSTFPVAPRYAK
MLALSQQHGCLPYTIAIVAAMTVRELFEELDREKELAELK
GRRARVAQMKRTWAGQGPSLKLGDLMVLLGAVGACEYAGC
SPQFCQANGLRYKAMLEIRRLRGQLTTAVNAVCPEDPKMQ
PPTESQVTYLRQIMAAGLGDHLARRVQSLDPKWKNAYKTP
LLDDPVFIHPSSVLFKELPEFVVYQEIVETTKMYMKGVST
VEIQWIPSLLPSYCQFDAPLEEPAPSYCPESGQVLCHRAS
VFYRVGWPLPAVQVDFPEGIDRYKYFAKFLLEGQVFRKLA
SFKSCLLSSPSTMLKTWARLQPRTETLLRALVAHKADSRD
SLLAAWKKNPKYLLAEYCEWLPKAMHSDVEKNWPPTTD
B:  VFIPVNRTPEMQEERLKLPILAEEQAIMEAVAEHPIVIVC
GETGSGKTTQVPQFLYEAGYSSEDSIIGVTEPRRVAAVAM
SQRVAKEMNLSHRVVSYQIRYEGNVTEETRIKFMTDGVLL
KEIQKDFLLLKYKVVIIDEAHERSVYTDILLGLLSRIVAL
RAKRHLPLKLLIMSATLRVEDFTQNQRLFTTPPPVIKVES
FPVTVHFNKRTPLDYSGECFRKVCKIHRMLPAGGILVFLT
GQAEVHALCRRLRKAFPSLPLHVLPLYSLLAPEKQAQVFK
PPPRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVT
GVSSFRVTWVSQASADQRAGRAGRTEPGHCYRLYSSAVFG
DFEQFPPPEITRRPVEDLILQMKALSIEKVINFPFPTPPS
VEALVAAEELLVALGALQAQMSQLSCPITALGRTMSTFPV
APRYAKMLALSQQHGCLPYTIAIVAAMTVRELFEELDLAE
LKGRRARVAQMKRTWAGQGPSLKLGDLMVLLGAVGACEYA
GCSPQFCQANGLRYKAMLEIRRLRGQLTTAVNAVCPPKMQ
PPTESQVTYLRQIMAAGLGDHLARRVQSLDPKWKNAYKTP
LLDDPVFIHPSSVLFKELPEFVVYQEIVETTKMYMKGVST
VEIQWIPSLLPSYCQFDAPLEEPAPSYCPESGQVLCHRAS
VFYRVGWPLPAVQVDFPEGIDRYKYFAKFLLEGQVFRKLA
SFKSCLLSSPSTMLKTWARLQPRTETLLRALVAHKADSRD
SLLAAWKKNPKYLLAEYCEWLPKAMHSDVEKNWPPTT
Description (1)  DEAH (Asp-Glu-Ala-His) box polypeptide 37/RNA Complex

Display surface

Download
Links