eF-site ID 6o0l-AC
PDB Code 6o0l
Chain A, C

click to enlarge
Title crystal structure of BCL-2 G101V mutation with venetoclax
Classification APOPTOSIS
Compound Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2
Source (BCL2_HUMAN)
Sequence A:  YDNREIVMKYIHYKLSQRGYEWDAGSEVVHLTLRQAVDDF
SRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
LHTWIQDNGGWDAFVELYG
C:  GYDNREIVMKYIHYKLSQRGYEWDAGSEVVHLTLRQAVDD
FSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
WGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYG
Description (1)  Apoptosis regulator Bcl-2


Functional site

1) chain A
residue 12
type
ligand
sequence R
description binding site for residue LBM A 301
source : AC1

2) chain A
residue 100
type
ligand
sequence A
description binding site for residue LBM A 301
source : AC1

3) chain A
residue 103
type
ligand
sequence D
description binding site for residue LBM A 301
source : AC1

4) chain A
residue 107
type
ligand
sequence R
description binding site for residue LBM A 301
source : AC1

5) chain A
residue 108
type
ligand
sequence Y
description binding site for residue LBM A 301
source : AC1

6) chain A
residue 137
type
ligand
sequence L
description binding site for residue LBM A 301
source : AC1

7) chain A
residue 144
type
ligand
sequence W
description binding site for residue LBM A 301
source : AC1

8) chain A
residue 145
type
ligand
sequence G
description binding site for residue LBM A 301
source : AC1

9) chain A
residue 148
type
ligand
sequence V
description binding site for residue LBM A 301
source : AC1

10) chain A
residue 149
type
ligand
sequence A
description binding site for residue LBM A 301
source : AC1

11) chain A
residue 152
type
ligand
sequence E
description binding site for residue LBM A 301
source : AC1

12) chain A
residue 153
type
ligand
sequence F
description binding site for residue LBM A 301
source : AC1

13) chain A
residue 156
type
ligand
sequence V
description binding site for residue LBM A 301
source : AC1

14) chain A
residue 198
type
ligand
sequence F
description binding site for residue LBM A 301
source : AC1

15) chain A
residue 202
type
ligand
sequence Y
description binding site for residue LBM A 301
source : AC1

16) chain A
residue 12
type
ligand
sequence R
description binding site for residue PEG A 302
source : AC2

17) chain A
residue 16
type
ligand
sequence M
description binding site for residue PEG A 302
source : AC2

18) chain A
residue 143
type
ligand
sequence N
description binding site for residue PEG A 303
source : AC3

19) chain A
residue 178
type
ligand
sequence T
description binding site for residue PEG A 303
source : AC3

20) chain A
residue 179
type
ligand
sequence E
description binding site for residue CL A 304
source : AC4

21) chain A
residue 182
type
ligand
sequence N
description binding site for residue CL A 304
source : AC4

22) chain A
residue 183
type
ligand
sequence R
description binding site for residue CL A 304
source : AC4

23) chain C
residue 12
type
ligand
sequence R
description binding site for residue LBM C 301
source : AC5

24) chain C
residue 100
type
ligand
sequence A
description binding site for residue LBM C 301
source : AC5

25) chain C
residue 103
type
ligand
sequence D
description binding site for residue LBM C 301
source : AC5

26) chain C
residue 107
type
ligand
sequence R
description binding site for residue LBM C 301
source : AC5

27) chain C
residue 108
type
ligand
sequence Y
description binding site for residue LBM C 301
source : AC5

28) chain C
residue 136
type
ligand
sequence E
description binding site for residue LBM C 301
source : AC5

29) chain C
residue 137
type
ligand
sequence L
description binding site for residue LBM C 301
source : AC5

30) chain C
residue 144
type
ligand
sequence W
description binding site for residue LBM C 301
source : AC5

31) chain C
residue 145
type
ligand
sequence G
description binding site for residue LBM C 301
source : AC5

32) chain C
residue 148
type
ligand
sequence V
description binding site for residue LBM C 301
source : AC5

33) chain C
residue 149
type
ligand
sequence A
description binding site for residue LBM C 301
source : AC5

34) chain C
residue 152
type
ligand
sequence E
description binding site for residue LBM C 301
source : AC5

35) chain C
residue 153
type
ligand
sequence F
description binding site for residue LBM C 301
source : AC5

36) chain C
residue 156
type
ligand
sequence V
description binding site for residue LBM C 301
source : AC5

37) chain C
residue 198
type
ligand
sequence F
description binding site for residue LBM C 301
source : AC5

38) chain C
residue 202
type
ligand
sequence Y
description binding site for residue LBM C 301
source : AC5

39) chain C
residue 12
type
ligand
sequence R
description binding site for residue PEG C 302
source : AC6

40) chain C
residue 12
type
ligand
sequence R
description binding site for residue PEG C 303
source : AC7

41) chain C
residue 143
type
ligand
sequence N
description binding site for residue PEG C 303
source : AC7

42) chain C
residue 146
type
ligand
sequence R
description binding site for residue PEG C 303
source : AC7

43) chain C
residue 179
type
ligand
sequence E
description binding site for residue CL C 304
source : AC8

44) chain C
residue 182
type
ligand
sequence N
description binding site for residue CL C 304
source : AC8

45) chain C
residue 183
type
ligand
sequence R
description binding site for residue CL C 304
source : AC8

46) chain A
residue 12
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

47) chain A
residue 16
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence M
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

48) chain A
residue 30
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence W
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

49) chain A
residue 32
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence A
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

50) chain A
residue 171
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence D
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

51) chain A
residue 174-175
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence AL
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

52) chain A
residue 178
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence T
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_302

53) chain A
residue 12
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_303

54) chain A
residue 175
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence L
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_303

55) chain A
residue 178
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence T
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_303

56) chain A
residue 182-183
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence NR
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_A_303

57) chain A
residue 99-100
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence QA
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

58) chain A
residue 103-104
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence DF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

59) chain A
residue 107-108
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence RY
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

60) chain A
residue 111-112
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence DF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

61) chain A
residue 115
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence M
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

62) chain A
residue 133
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence V
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

63) chain A
residue 136-137
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence EL
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

64) chain A
residue 143-146
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence NWGR
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

65) chain A
residue 148-149
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence VA
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

66) chain A
residue 152-153
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence EF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

67) chain A
residue 156
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence V
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

68) chain A
residue 198
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence F
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

69) chain A
residue 202
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence Y
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_A_301

70) chain C
residue 12
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

71) chain C
residue 16
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence M
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

72) chain C
residue 30
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence W
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

73) chain C
residue 32
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence A
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

74) chain C
residue 174-175
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence AL
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

75) chain C
residue 178
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence T
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_302

76) chain C
residue 12
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence R
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_303

77) chain C
residue 175
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence L
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_303

78) chain C
residue 178-179
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence TE
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_303

79) chain C
residue 182-183
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence NR
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6o0l_C_303

80) chain C
residue 99-100
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence QA
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

81) chain C
residue 103-104
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence DF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

82) chain C
residue 107-108
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence RY
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

83) chain C
residue 111-112
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence DF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

84) chain C
residue 115
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence M
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

85) chain C
residue 133
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence V
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

86) chain C
residue 136-137
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence EL
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

87) chain C
residue 143-146
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence NWGR
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

88) chain C
residue 148-149
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence VA
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

89) chain C
residue 152-153
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence EF
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

90) chain C
residue 156
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence V
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

91) chain C
residue 198
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence F
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301

92) chain C
residue 202
type binding
ligand LBM: 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide
sequence Y
description 4-[4-[[2-(4-chlorophenyl)-4,4-dimethyl-cyclohexen-1-yl]methyl]piperazin-1-yl]-~{N}-[4-(oxan-4-ylmethylamino)-3-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide binding site
source pdb_hetatom : LBM_6o0l_C_301


Display surface

Download
Links