eF-site ID 6nrb-P PDB Code 6nrb Chain P click to enlarge Title hTRiC-hPFD Class2 Classification CHAPERONE Compound T-complex protein 1 subunit alpha Source (PFD6_HUMAN) Sequence P:  AKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVIN HLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVG DGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRK AHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVF LAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVL HGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVL IKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVA DMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTP PVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLR GSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIE LAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGV KANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGIL DTYLGKYWAIKLATNAAVTVLRVDQIIMA Description Functional site 1) chain P residue 23 type MOD_RES sequence S description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI1 2) chain P residue 30 type MOD_RES sequence Y description N6-acetyllysine; alternate => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2 3) chain P residue 162 type CROSSLNK sequence S description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 4) chain P residue 213 type CROSSLNK sequence S description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 5) chain P residue 269 type CROSSLNK sequence S description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 6) chain P residue 317 type CROSSLNK sequence S description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 7) chain P residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 8) chain P residue 254 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 9) chain P residue 260 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 10) chain P residue 459 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) => ECO:0007744|PubMed:25114211 source Swiss-Prot : SWS_FT_FI7 11) chain P residue 318 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 12) chain P residue 400 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 13) chain P residue 466 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 14) chain P residue 505 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links