eF-site ID 6npt-A PDB Code 6npt Chain A click to enlarge Title TRK-A IN COMPLEX WITH LIGAND 1 Classification TRANSFERASE Compound High affinity nerve growth factor receptor Source (NTRK1_HUMAN) Sequence A:  IENCVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQD KMLVAVKALKEARQDFQREAELLTMLQHQHIVRFFGVCTE GRPLLMVFEYMRHGDLNRFLRSHGPGGEDVAPGPLGLGQL LAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIG DFGMSRDIYXTDYYRVGGRTMLPIRWMPPESILYRKFTTE SDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELE RPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQA PPVYLDVL Description (1)  High affinity nerve growth factor receptor (E.C.2.7.10.1) Functional site 1) chain A residue 544 type sequence K description binding site for residue KWY A 801 source : AC1 2) chain A residue 560 type sequence E description binding site for residue KWY A 801 source : AC1 3) chain A residue 567 type sequence L description binding site for residue KWY A 801 source : AC1 4) chain A residue 572 type sequence I description binding site for residue KWY A 801 source : AC1 5) chain A residue 666 type sequence I description binding site for residue KWY A 801 source : AC1 6) chain A residue 668 type sequence D description binding site for residue KWY A 801 source : AC1 7) chain A residue 670 type sequence G description binding site for residue KWY A 801 source : AC1 8) chain A residue 673 type sequence R description binding site for residue KWY A 801 source : AC1 9) chain A residue 748 type ACT_SITE sequence R description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 614 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 642 type BINDING sequence A description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 584 type SITE sequence P description Breakpoint for translocation to form TRK-T1 source Swiss-Prot : SWS_FT_FI5 13) chain A residue 594 type SITE sequence H description Interaction with SHC1 source Swiss-Prot : SWS_FT_FI6 14) chain A residue 522-537 type TRANSMEM sequence GKVFLAECHNLLPEQD description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 594 type MOD_RES sequence H description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:15488758, ECO:0000269|PubMed:27676246, ECO:0000269|PubMed:8155326 source Swiss-Prot : SWS_FT_FI7 16) chain A residue 516-544 type prosite sequence LGEGAFGKVFLAECHNLLPEQDKMLVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGAFGKVFlAechnllpeqdkml.....VAVK source prosite : PS00107 17) chain A residue 646-658 type prosite sequence FVHRDLATRNCLV description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FVHrDLATRNCLV source prosite : PS00109 18) chain A residue 674-682 type prosite sequence DIYXTDYYR description RECEPTOR_TYR_KIN_II Receptor tyrosine kinase class II signature. DIYstdYYR source prosite : PS00239 19) chain A residue 774 type MOD_RES sequence I description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:8155326 source Swiss-Prot : SWS_FT_FI8 20) chain A residue 778 type MOD_RES sequence H description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:15488758, ECO:0000269|PubMed:8155326 source Swiss-Prot : SWS_FT_FI9 21) chain A residue 779 type MOD_RES sequence A description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:15488758, ECO:0000269|PubMed:8155326 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links