eF-site ID 6nmf-M PDB Code 6nmf Chain M click to enlarge Title SFX structure of reduced cytochrome c oxidase at room temperature Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: Bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence M:  ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNY KKS Description Functional site 1) chain M residue 4 type sequence K description binding site for residue PGV A 607 source : AC7 2) chain M residue 12 type sequence P description binding site for residue PGV A 607 source : AC7 3) chain M residue 15 type sequence Q description binding site for residue PGV A 607 source : AC7 4) chain M residue 28 type sequence L description binding site for residue DMU M 101 source : AF1 5) chain M residue 32 type sequence W description binding site for residue DMU M 101 source : AF1 6) chain M residue 35 type sequence Y description binding site for residue DMU M 101 source : AF1 7) chain M residue 36 type sequence H description binding site for residue DMU M 101 source : AF1 8) chain M residue 1-11 type TOPO_DOM sequence ITAKPAKTPTS description Mitochondrial matrix => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI1 9) chain M residue 12-35 type TRANSMEM sequence PKEQAIGLSVTFLSFLLPAGWVLY description Helical => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links