eF-site ID 6nkj-B
PDB Code 6nkj
Chain B

click to enlarge
Title 1.3 Angstrom Resolution Crystal Structure of UDP-N-acetylglucosamine 1-carboxyvinyltransferase from Streptococcus pneumoniae in Complex with (2R)-2-(phosphonooxy)propanoic acid.
Classification TRANSFERASE
Compound UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Source (MURA1_STRPN)
Sequence B:  MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGK
TVLQNVPILSDVFIMNQVVGGLNAKVDFDEEAHLVKVDAT
GDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHI
YMDFPSVGATQNLMMAATLADGVTVIENAAREPEIVDLAI
LLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEE
DEGIRVRSQLENLKAVHVKTLPHPGFPTDMQAQFTALMTV
AKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLD
RGYYGFHEKLAQLGAKIQRIE
Description (1)  Adenosylhomocysteinase (E.C.3.3.1.1, 1.8.1.7)


Functional site

1) chain B
residue 344
type
ligand
sequence R
description binding site for residue CL A 503
source : AC3

2) chain B
residue 226
type
ligand
sequence H
description binding site for residue EDO B 502
source : AC4

3) chain B
residue 299
type
ligand
sequence K
description binding site for residue EDO B 502
source : AC4

4) chain B
residue 23
type
ligand
sequence K
description binding site for residue CIT B 503
source : AC5

5) chain B
residue 24
type
ligand
sequence N
description binding site for residue CIT B 503
source : AC5

6) chain B
residue 122
type
ligand
sequence I
description binding site for residue CIT B 503
source : AC5

7) chain B
residue 125
type
ligand
sequence R
description binding site for residue CIT B 503
source : AC5

8) chain B
residue 309
type
ligand
sequence D
description binding site for residue CIT B 503
source : AC5

9) chain B
residue 332
type
ligand
sequence F
description binding site for residue CIT B 503
source : AC5

10) chain B
residue 335
type
ligand
sequence R
description binding site for residue CIT B 503
source : AC5

11) chain B
residue 374
type
ligand
sequence L
description binding site for residue CIT B 503
source : AC5

12) chain B
residue 375
type
ligand
sequence R
description binding site for residue CIT B 503
source : AC5

13) chain B
residue 401
type
ligand
sequence R
description binding site for residue CIT B 503
source : AC5

14) chain B
residue 203
type
ligand
sequence N
description binding site for residue CL B 504
source : AC6

15) chain B
residue 96
type
ligand
sequence R
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

16) chain B
residue 119
type
ligand
sequence G
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

17) chain B
residue 121
type
ligand
sequence T
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

18) chain B
residue 122
type
ligand
sequence I
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

19) chain B
residue 123
type
ligand
sequence G
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

20) chain B
residue 125
type
ligand
sequence R
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

21) chain B
residue 401
type
ligand
sequence R
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

22) chain B
residue 23-24
type binding
ligand CIT: CITRIC ACID
sequence KN
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

23) chain B
residue 51
type binding
ligand CIT: CITRIC ACID
sequence D
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

24) chain B
residue 97
type binding
ligand CIT: CITRIC ACID
sequence A
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

25) chain B
residue 120
type binding
ligand CIT: CITRIC ACID
sequence C
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

26) chain B
residue 122
type binding
ligand CIT: CITRIC ACID
sequence I
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

27) chain B
residue 125
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

28) chain B
residue 309
type binding
ligand CIT: CITRIC ACID
sequence D
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

29) chain B
residue 332
type binding
ligand CIT: CITRIC ACID
sequence F
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

30) chain B
residue 335
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

31) chain B
residue 373-375
type binding
ligand CIT: CITRIC ACID
sequence DLR
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

32) chain B
residue 401
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_B_503

33) chain B
residue 39-40
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GK
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6nkj_B_502

34) chain B
residue 226
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence H
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6nkj_B_502

35) chain B
residue 92-96
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence VSKMR
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_B_501

36) chain B
residue 119-122
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence GCTI
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_B_501

37) chain B
residue 125
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence R
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_B_501

38) chain B
residue 401
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence R
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_B_501


Display surface

Download
Links