eF-site ID 6nkj-A
PDB Code 6nkj
Chain A

click to enlarge
Title 1.3 Angstrom Resolution Crystal Structure of UDP-N-acetylglucosamine 1-carboxyvinyltransferase from Streptococcus pneumoniae in Complex with (2R)-2-(phosphonooxy)propanoic acid.
Classification TRANSFERASE
Compound UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Source (MURA1_STRPN)
Sequence A:  MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGK
TVLQNVPILSDVFIMNQVVGGLNAKVDFDEEAHLVKVDAT
GDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHI
YMDFPSVGATQNLMMAATLADGVTVIENAAREPEIVDLAI
LLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEE
DEGIRVRSQLENLKAVHVKTLPHPGFPTDMQAQFTALMTV
AKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLD
RGYYGFHEKLAQLGAKIQRIE
Description (1)  Adenosylhomocysteinase (E.C.3.3.1.1, 1.8.1.7)


Functional site

1) chain A
residue 96
type
ligand
sequence R
description binding site for residue 0V5 A 501
source : AC1

2) chain A
residue 120
type
ligand
sequence C
description binding site for residue 0V5 A 501
source : AC1

3) chain A
residue 121
type
ligand
sequence T
description binding site for residue 0V5 A 501
source : AC1

4) chain A
residue 401
type
ligand
sequence R
description binding site for residue 0V5 A 501
source : AC1

5) chain A
residue 23
type
ligand
sequence K
description binding site for residue CIT A 502
source : AC2

6) chain A
residue 24
type
ligand
sequence N
description binding site for residue CIT A 502
source : AC2

7) chain A
residue 122
type
ligand
sequence I
description binding site for residue CIT A 502
source : AC2

8) chain A
residue 125
type
ligand
sequence R
description binding site for residue CIT A 502
source : AC2

9) chain A
residue 309
type
ligand
sequence D
description binding site for residue CIT A 502
source : AC2

10) chain A
residue 335
type
ligand
sequence R
description binding site for residue CIT A 502
source : AC2

11) chain A
residue 374
type
ligand
sequence L
description binding site for residue CIT A 502
source : AC2

12) chain A
residue 375
type
ligand
sequence R
description binding site for residue CIT A 502
source : AC2

13) chain A
residue 401
type
ligand
sequence R
description binding site for residue CIT A 502
source : AC2

14) chain A
residue 115
type
ligand
sequence S
description binding site for residue CL A 503
source : AC3

15) chain A
residue 146
type
ligand
sequence G
description binding site for residue CL A 503
source : AC3

16) chain A
residue 147
type
ligand
sequence Y
description binding site for residue CL A 503
source : AC3

17) chain A
residue 340
type
ligand
sequence E
description binding site for Di-peptide 0V5 B 501 and CYS B 120
source : AC7

18) chain A
residue 23-24
type binding
ligand CIT: CITRIC ACID
sequence KN
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

19) chain A
residue 51
type binding
ligand CIT: CITRIC ACID
sequence D
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

20) chain A
residue 120
type binding
ligand CIT: CITRIC ACID
sequence C
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

21) chain A
residue 122
type binding
ligand CIT: CITRIC ACID
sequence I
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

22) chain A
residue 125
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

23) chain A
residue 309
type binding
ligand CIT: CITRIC ACID
sequence D
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

24) chain A
residue 332
type binding
ligand CIT: CITRIC ACID
sequence F
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

25) chain A
residue 335
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

26) chain A
residue 373-375
type binding
ligand CIT: CITRIC ACID
sequence DLR
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

27) chain A
residue 401
type binding
ligand CIT: CITRIC ACID
sequence R
description CITRIC ACID binding site
source pdb_hetatom : CIT_6nkj_A_502

28) chain A
residue 92-96
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence VSKMR
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_A_501

29) chain A
residue 119-122
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence GCTI
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_A_501

30) chain A
residue 125
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence R
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_A_501

31) chain A
residue 401
type binding
ligand 0V5: (2R)-2-(phosphonooxy)propanoic acid
sequence R
description (2R)-2-(phosphonooxy)propanoic acid binding site
source pdb_hetatom : 0V5_6nkj_A_501


Display surface

Download
Links