eF-site ID 6njk-A
PDB Code 6njk
Chain A

click to enlarge
Title Crystal structure of beta-lactamase from Sulfitobacter sp. EE-36
Classification HYDROLASE
Compound beta-lactamase
Source (6NJK)
Sequence A:  SATSEQIVDIADASFAPVIEQYRIPGLVVGITWQGQHSFY
ATGVAARKGNVAATPDTIFELGSISKIFTATLAALAEDRG
XLDLDAPVSDSIPQLEGAAFGAIRLVDLSTHVTGGLPLQV
PGEVGNVAELIRWLESWQPPQPGTRSYSNVSIGLLGHITA
QTXGXSFAQAAQDVLFPAXGLGSTYVDVPDDAXDRYAFGY
DRKTDAPIRVNPGVLADEAYGVKSTARDXLRLLDLELGRG
GANPALTAALERTRQGQAETAYYTQDXIWEQYPWPVDVAR
XEAGNGYDFILSPQPATRLTPPLPPQRDVILNKTGATNGF
GGYVALLPGQDLGIVVLANRNYPNEARVRATHALITDLLA
TQ
Description (1)  Beta-lactamase (E.C.3.5.2.6)


Functional site

1) chain A
residue 105
type
ligand
sequence G
description binding site for residue ACT A 401
source : AC1

2) chain A
residue 107
type
ligand
sequence L
description binding site for residue ACT A 401
source : AC1

3) chain A
residue 105
type binding
ligand ACT: ACETATE ION
sequence G
description ACETATE ION binding site
source pdb_hetatom : ACT_6njk_A_401

4) chain A
residue 107-108
type binding
ligand ACT: ACETATE ION
sequence LD
description ACETATE ION binding site
source pdb_hetatom : ACT_6njk_A_401

5) chain A
residue 111
type binding
ligand ACT: ACETATE ION
sequence A
description ACETATE ION binding site
source pdb_hetatom : ACT_6njk_A_401


Display surface

Download
Links