eF-site ID 6nji-AB PDB Code 6nji Chain A, B click to enlarge Title Crystal Structure of the PDE4D Catalytic Domain and UCR2 Regulatory Helix with T-49 Classification HYDROLASE/HYDROLASE INHIBITOR Compound cAMP-specific 3',5'-cyclic phosphodiesterase 4D Source (PDE4D_HUMAN) Sequence A:  EQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIF QERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAA DVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPG VSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENC DIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTM VETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPL QLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVE KSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWY QSTIPQNQVSEFISNTFLD B:  QEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQ ERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAAD VVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGV SNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCD IFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMV ETKKVTVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYR QWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQV GFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTI PQNQVSEFISNTFLD Description (1)  cAMP-specific 3',5'-cyclic phosphodiesterase 4D (E.C.3.1.4.53) Functional site 1) chain A residue 330 type ligand sequence H description binding site for residue ZN A 700 source : AC1 2) chain A residue 366 type ligand sequence H description binding site for residue ZN A 700 source : AC1 3) chain A residue 367 type ligand sequence D description binding site for residue ZN A 700 source : AC1 4) chain A residue 484 type ligand sequence D description binding site for residue ZN A 700 source : AC1 5) chain A residue 367 type ligand sequence D description binding site for residue MG A 701 source : AC2 6) chain A residue 487 type ligand sequence N description binding site for residue KR4 A 702 source : AC3 7) chain A residue 499 type ligand sequence T description binding site for residue KR4 A 702 source : AC3 8) chain A residue 535 type ligand sequence Q description binding site for residue KR4 A 702 source : AC3 9) chain A residue 538 type ligand sequence F description binding site for residue KR4 A 702 source : AC3 10) chain A residue 599 type ligand sequence F description binding site for residue KR4 A 702 source : AC3 11) chain B residue 330 type ligand sequence H description binding site for residue ZN B 700 source : AC4 12) chain B residue 366 type ligand sequence H description binding site for residue ZN B 700 source : AC4 13) chain B residue 367 type ligand sequence D description binding site for residue ZN B 700 source : AC4 14) chain B residue 484 type ligand sequence D description binding site for residue ZN B 700 source : AC4 15) chain B residue 367 type ligand sequence D description binding site for residue MG B 701 source : AC5 16) chain B residue 487 type ligand sequence N description binding site for residue KR4 B 702 source : AC6 17) chain B residue 499 type ligand sequence T description binding site for residue KR4 B 702 source : AC6 18) chain B residue 535 type ligand sequence Q description binding site for residue KR4 B 702 source : AC6 19) chain B residue 538 type ligand sequence F description binding site for residue KR4 B 702 source : AC6 20) chain B residue 599 type ligand sequence F description binding site for residue KR4 B 702 source : AC6 21) chain A residue 366-377 type prosite ligand sequence HDVDHPGVSNQF description 3'5'-cyclic nucleotide phosphodiesterase domain signature.H-D-[LIVMFY]-x-H-x-[AG]-x(2)-[NQ]-x-[LIVMFY]. source prosite : PS00126 22) chain B residue 366-377 type prosite ligand sequence HDVDHPGVSNQF description 3'5'-cyclic nucleotide phosphodiesterase domain signature.H-D-[LIVMFY]-x-H-x-[AG]-x(2)-[NQ]-x-[LIVMFY]. source prosite : PS00126

Display surface Download Links