eF-site ID 6nji-A
PDB Code 6nji
Chain A

click to enlarge
Title Crystal Structure of the PDE4D Catalytic Domain and UCR2 Regulatory Helix with T-49
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Source (PDE4D_HUMAN)
Sequence A:  EQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIF
QERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAA
DVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPG
VSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENC
DIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTM
VETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPL
QLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVE
KSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWY
QSTIPQNQVSEFISNTFLD
Description (1)  cAMP-specific 3',5'-cyclic phosphodiesterase 4D (E.C.3.1.4.53)


Functional site

1) chain A
residue 330
type
ligand
sequence H
description binding site for residue ZN A 700
source : AC1

2) chain A
residue 366
type
ligand
sequence H
description binding site for residue ZN A 700
source : AC1

3) chain A
residue 367
type
ligand
sequence D
description binding site for residue ZN A 700
source : AC1

4) chain A
residue 484
type
ligand
sequence D
description binding site for residue ZN A 700
source : AC1

5) chain A
residue 367
type
ligand
sequence D
description binding site for residue MG A 701
source : AC2

6) chain A
residue 487
type
ligand
sequence N
description binding site for residue KR4 A 702
source : AC3

7) chain A
residue 499
type
ligand
sequence T
description binding site for residue KR4 A 702
source : AC3

8) chain A
residue 535
type
ligand
sequence Q
description binding site for residue KR4 A 702
source : AC3

9) chain A
residue 538
type
ligand
sequence F
description binding site for residue KR4 A 702
source : AC3

10) chain A
residue 599
type
ligand
sequence F
description binding site for residue KR4 A 702
source : AC3

11) chain A
residue 366-377
type prosite
ligand
sequence HDVDHPGVSNQF
description 3'5'-cyclic nucleotide phosphodiesterase domain signature.H-D-[LIVMFY]-x-H-x-[AG]-x(2)-[NQ]-x-[LIVMFY].
source prosite : PS00126


Display surface

Download
Links