eF-site ID 6nje-A
PDB Code 6nje
Chain A

click to enlarge
Title Crystal structure of the motor domain of human kinesin family member 22
Classification TRANSPORT PROTEIN
Compound Kinesin-like protein KIF22
Source (KIF22_HUMAN)
Sequence A:  LYFQGPPARVRVAVRLRPFVCSLEIANWRNHQETLKYQFD
AFYGERSTQQDIYAGSVQPILRHLLEGQNASVLAYGPTGA
GKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALS
VTMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLS
QKPISSFADFERHFLPASRRSSRSHAVLLVKVDQRERLAP
FRQREGKLYLIDLAGSEDNRRTGAINTSLFVLGKVVDALN
QGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFY
LDTVSALNFAARSKEVI
Description (1)  kif22


Functional site

1) chain A
residue 134
type
ligand
sequence T
description binding site for residue MG A 801
source : AC1

2) chain A
residue 49
type
ligand
sequence R
description binding site for residue ADP A 802
source : AC2

3) chain A
residue 51
type
ligand
sequence R
description binding site for residue ADP A 802
source : AC2

4) chain A
residue 52
type
ligand
sequence P
description binding site for residue ADP A 802
source : AC2

5) chain A
residue 128
type
ligand
sequence P
description binding site for residue ADP A 802
source : AC2

6) chain A
residue 129
type
ligand
sequence T
description binding site for residue ADP A 802
source : AC2

7) chain A
residue 130
type
ligand
sequence G
description binding site for residue ADP A 802
source : AC2

8) chain A
residue 131
type
ligand
sequence A
description binding site for residue ADP A 802
source : AC2

9) chain A
residue 132
type
ligand
sequence G
description binding site for residue ADP A 802
source : AC2

10) chain A
residue 133
type
ligand
sequence K
description binding site for residue ADP A 802
source : AC2

11) chain A
residue 134
type
ligand
sequence T
description binding site for residue ADP A 802
source : AC2

12) chain A
residue 135
type
ligand
sequence H
description binding site for residue ADP A 802
source : AC2

13) chain A
residue 45
type
ligand
sequence R
description binding site for residue CL A 803
source : AC3

14) chain A
residue 97
type
ligand
sequence R
description binding site for residue CL A 803
source : AC3

15) chain A
residue 120
type
ligand
sequence N
description binding site for residue CL A 804
source : AC4

16) chain A
residue 336
type
ligand
sequence S
description binding site for residue CL A 804
source : AC4

17) chain A
residue 337
type
ligand
sequence A
description binding site for residue CL A 804
source : AC4

18) chain A
residue 99
type
ligand
sequence T
description binding site for residue CL A 805
source : AC5

19) chain A
residue 100
type
ligand
sequence Q
description binding site for residue CL A 805
source : AC5

20) chain A
residue 143
type
ligand
sequence Q
description binding site for residue CL A 805
source : AC5

21) chain A
residue 35
type
ligand
sequence L
description binding site for residue NA A 806
source : AC6

22) chain A
residue 36
type
ligand
sequence Y
description binding site for residue NA A 806
source : AC6

23) chain A
residue 37
type
ligand
sequence F
description binding site for residue NA A 806
source : AC6

24) chain A
residue 38
type
ligand
sequence Q
description binding site for residue NA A 806
source : AC6

25) chain A
residue 39
type
ligand
sequence G
description binding site for residue NA A 806
source : AC6

26) chain A
residue 49
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_6nje_A_802

27) chain A
residue 51-52
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence RP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_6nje_A_802

28) chain A
residue 54
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_6nje_A_802

29) chain A
residue 128-135
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence PTGAGKTH
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_6nje_A_802

30) chain A
residue 274
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence D
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_6nje_A_802


Display surface

Download
Links