eF-site ID 6nd4-K
PDB Code 6nd4
Chain K

click to enlarge
Title Conformational switches control early maturation of the eukaryotic small ribosomal subunit
Classification RIBOSOME
Compound 5'ETS rRNA
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae BY4741;
Sequence K:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHLSK
IFLTISKSITQNPWNEENLLPLWLKWLLTLKSGELNSIKD
KHTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLRRQAKL
RED
Description (1)  ribosome

Display surface

Download
Links