eF-site ID 6ncw-D PDB Code 6ncw Chain D click to enlarge Title Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol Classification HYDROLASE Compound Beta-galacturonidase Source (A0A1E3AEY6_9FIRM) Sequence D:  MIRTFETHKIRKTAELSSALWNFHTIGTQGEEAVIQAPVP GCWENYPDTVSYRGQASYSREFEAKGNIRLEFKGVSHTAS VLVDGKPVGSHYNAYTPFDVVLKDIRPGIHQLEVIADNSF GPDSALHVPNDYQSYGGISRGVVLEELGEAYLSWIHFTPF LRKDGWYGKAEICVRNLSSGRLDGSVEVEIGKNSFAVLPI VLEGEEEKSFSTEELPCPWAECWSPESPVLYLITAVLRTA DDIIDRVGFREIRTEGKDILLNGRKLRIKGFCRHEDHPQF GCALPFSAMQHDLMLIKDLGANSIRTVHYPNDELFLDLCD EQGILVWEENHARGLSEENMRNPHFKQQCGDCIREMITAH YNHPSIYIWGILNECASDTEYGRECYSEQYELIKSLDPYR PRSSASCRFKTDICLGYPEVVSYNIYPKWYHDVPVEDYLD ELYQWIQNESEGTGKPFLITEIGAGAIYGYRTPAHVKWSE EYQVQALKEQLQAVFSREGCSGVYIWQFCDVRVCDSWFGS RPRTMNNKGIVDEYRRPKLAYEVVKDSYRSLGNYFENLYF Description Functional site 1) chain D residue 482 type sequence W description binding site for residue CL D 601 source : AD3 2) chain D residue 531 type sequence N description binding site for residue CL D 601 source : AD3 3) chain D residue 532 type sequence K description binding site for residue CL D 601 source : AD3 4) chain D residue 131 type sequence D description binding site for residue GOL D 602 source : AD4 5) chain D residue 312 type sequence H description binding site for residue GOL D 602 source : AD4 6) chain D residue 337 type sequence R description binding site for residue GOL D 602 source : AD4 7) chain D residue 377 type sequence N description binding site for residue GOL D 602 source : AD4 8) chain D residue 378 type sequence E description binding site for residue GOL D 602 source : AD4 9) chain D residue 428 type sequence N description binding site for residue GOL D 602 source : AD4 10) chain D residue 465 type sequence E description binding site for residue GOL D 602 source : AD4 11) chain D residue 510 type sequence W description binding site for residue GOL D 602 source : AD4 12) chain D residue 337 type sequence R description binding site for residue GOL D 603 source : AD5 13) chain D residue 378 type sequence E description binding site for residue GOL D 603 source : AD5 14) chain D residue 430 type sequence Y description binding site for residue GOL D 603 source : AD5 15) chain D residue 434 type sequence Y description binding site for residue GOL D 603 source : AD5 16) chain D residue 525 type sequence R description binding site for residue GOL D 603 source : AD5

Display surface Download Links