eF-site ID 6ncw-C PDB Code 6ncw Chain C click to enlarge Title Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol Classification HYDROLASE Compound Beta-galacturonidase Source (A0A1E3AEY6_9FIRM) Sequence C:  MIRTFETHKIRKTAELSSALWNFHTIGTQGEEAVIQAPVP GCWENYPDTVSYRGQASYSREFEAKGNIRLEFKGVSHTAS VLVDGKPVGSHYNAYTPFDVVLKDIRPGIHQLEVIADNSF GPDSALHVPNDYQSYGGISRGVVLEELGEAYLSWIHFTPF LRKDGWYGKAEICVRNLSSGRLDGSVEVEIGKNSFAVLPI VLEGEEEKSFSTEELPCPWAECWSPESPVLYLITAVLRTA DGAADDIIDRVGFREIRTEGKDILLNGRKLRIKGFCRHED HPQFGCALPFSAMQHDLMLIKDLGANSIRTVHYPNDELFL DLCDEQGILVWEENHARGLSEENMRNPHFKQQCGDCIREM ITAHYNHPSIYIWGILNECASDTEYGRECYSEQYELIKSL DPYRPRSSASCRFKTDICLGYPEVVSYNIYPKWYHDVPVE DYLDELYQWIQNESEGTGKPFLITEIGAGAIYGYRTPAHV KWSEEYQVQALKEQLQAVFSREGCSGVYIWQFCDVRVCDS WFGSRPRTMNNKGIVDEYRRPKLAYEVVKDSYRSLGNYF Description Functional site 1) chain C residue 482 type sequence W description binding site for residue CL C 601 source : AC9 2) chain C residue 531 type sequence N description binding site for residue CL C 601 source : AC9 3) chain C residue 532 type sequence K description binding site for residue CL C 601 source : AC9 4) chain C residue 131 type sequence D description binding site for residue GOL C 602 source : AD1 5) chain C residue 312 type sequence H description binding site for residue GOL C 602 source : AD1 6) chain C residue 337 type sequence R description binding site for residue GOL C 602 source : AD1 7) chain C residue 377 type sequence N description binding site for residue GOL C 602 source : AD1 8) chain C residue 378 type sequence E description binding site for residue GOL C 602 source : AD1 9) chain C residue 428 type sequence N description binding site for residue GOL C 602 source : AD1 10) chain C residue 465 type sequence E description binding site for residue GOL C 602 source : AD1 11) chain C residue 510 type sequence W description binding site for residue GOL C 602 source : AD1 12) chain C residue 337 type sequence R description binding site for residue GOL C 603 source : AD2 13) chain C residue 378 type sequence E description binding site for residue GOL C 603 source : AD2 14) chain C residue 430 type sequence Y description binding site for residue GOL C 603 source : AD2 15) chain C residue 434 type sequence Y description binding site for residue GOL C 603 source : AD2 16) chain C residue 525 type sequence R description binding site for residue GOL C 603 source : AD2

Display surface Download Links